Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.11
PubTator Score 10.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 2.700 5.7e-04
osteosarcoma -3.581 1.2e-08
lung cancer -1.300 1.6e-02
interstitial cystitis 2.400 6.4e-03
primary Sjogren syndrome 2.100 1.2e-03
nasopharyngeal carcinoma -1.100 3.1e-02
lung carcinoma -2.400 5.1e-28
acute myeloid leukemia 1.100 4.0e-02
ulcerative colitis 1.500 3.5e-03

 GO Process (1)

Gene RIF (6)

PMID Text
26152201 Data identified rs28445040 variant in SP140 gene as the causal factor for skipping of exon 7 and the most associated with multiple sclerosis.
20731705 Observational study of gene-disease association. (HuGE Navigator)
20332261 Observational study of gene-disease association. (HuGE Navigator)
19149577 Wild-type HIV-1 Vif binds to the carboxyl-terminal region of Sp140 between amino acids 527-836, while Vif mutants with deletions of amino acids 12-23, 43-59, 73-87 or 97-112 are strongly inhibited in their binding to Sp140
12368356 the nuclear body protein Sp140, was found specifically in all NP cells (n = 12 cell lines tested; P < or = 0.001), and HIV-1 infection induced its partial dispersal from nuclear bodies into cytosolic colocalization with Vif
12368356 Wild-type HIV-1 Vif binds to the carboxyl-terminal region of Sp140 between amino acids 527-836, while Vif mutants with deletions of amino acids 12-23, 43-59, 73-87 or 97-112 are strongly inhibited in their binding to Sp140

AA Sequence

MAQQGQQGQMASGDSNLNFRMVAEIQNVEGQNLQEQVCPEPIFRFFRENKVEIASAITRPFPFLMGLRDR      1 - 70
SFISEQMYEHFQEAFRNLVPVTRVMYCVLSELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEH     71 - 140
SPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDA    141 - 210
EDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLPYDTEVLESNGMIDAARTYSTAPGEKQGEEEGRNSPRK    211 - 280
RNQDKEKYQESPEGRDKETFDLKTPQVTNEGEPEKGLCLLPGEGEEGSDDCSEMCDGEEPQEASSSLARC    281 - 350
GSVSCLSAETFDLKTPQVTNEGEPEKELSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELEN    351 - 420
HPMNEEGESEELASSLLYDNVPGAEQSAYENEKCSCVMCFSEEVPGSPEARTESDQACGTMDTVDIANNS    421 - 490
TLGKPKRKRRKKRGHGWSRMRMRRQENSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFT    491 - 560
QSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILVKCIQTEDGKWFTPTEFEI    561 - 630
KGGHARSKNWRLSVRCGGWPLRWLMENGFLPDPPRIRYRKKKRILKSQNNSSVDPCMRNLDECEVCRDGG    631 - 700
ELFCCDTCSRVFHEDCHIPPVEAERTPWNCIFCRMKESPGSQQCCQESEVLERQMCPEEQLKCEFLLLKV    701 - 770
YCCSESSFFAKIPYYYYIREACQGLKEPMWLDKIKKRLNEHGYPQVEGFVQDMRLIFQNHRASYKYKDFG    771 - 840
QMGFRLEAEFEKNFKEVFAIQETNGNN                                               841 - 867
//

Text Mined References (20)

PMID Year Title
26888452 2016 Whole Genome DNA Methylation Analysis of Obstructive Sleep Apnea: IL1R2, NPR2, AR, SP140 Methylation and Clinical Phenotype.
26152201 2015 A functional variant that affects exon-skipping and protein expression of SP140 as genetic mechanism predisposing to multiple sclerosis.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24267382 2014 Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22700719 2012 Common variation at 6p21.31 (BAK1) influences the risk of chronic lymphocytic leukemia.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20731705 2010 Genetic susceptibility for chronic lymphocytic leukemia among Chinese in Hong Kong.
20332261 2010 Genetic susceptibility variants for chronic lymphocytic leukemia.
19861957 2010 PML nuclear body component Sp140 is a novel autoantigen in primary biliary cirrhosis.
18758461 2008 A genome-wide association study identifies six susceptibility loci for chronic lymphocytic leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368356 2002 Implication of the lymphocyte-specific nuclear body protein Sp140 in an innate response to human immunodeficiency virus type 1.
8910577 1996 Identification and characterization of a leukocyte-specific component of the nuclear body.
8695863 1996 LYSP100-associated nuclear domains (LANDs): description of a new class of subnuclear structures and their relationship to PML nuclear bodies.