Property Summary

NCBI Gene PubMed Count 38
PubMed Score 35.50
PubTator Score 96.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 1.0e-03
juvenile dermatomyositis 1.445 8.0e-17
tuberculosis 1.100 2.9e-04
lung cancer -1.900 3.7e-04
interstitial cystitis 1.700 1.9e-03
pilocytic astrocytoma 1.100 5.2e-07
subependymal giant cell astrocytoma 1.400 1.1e-02
ulcerative colitis 1.100 5.5e-06
ovarian cancer -1.800 4.1e-07
pituitary cancer -1.500 2.5e-06

Gene RIF (31)

PMID Text
25980612 Infectious wild type HIV-1 production is enhanced by 293T cells over-expressing SP110
25006821 Results show that SP110 variants were associated with increased susceptibility to both pulmonary and extra-pulmonary tuberculosis in the Vietnamese patients. Those variants may influence macrophage signaling responses and apoptosis during the infection.
23129390 Study suggests that a combination of SP110 and MYBBP1A gene polymorphisms may serve as a novel marker for identifying the risk of developing TB in the Chinese Han population.
22691368 In a pooled analysis of 10,624 cases of tuberculosis, there was not a significant association between polymorphisms in the SP110 gene and disease susceptibility. [Meta-analysis]
22621957 a range of mutations in SP110 that cause decreased SP110 protein levels and impaired late B-cell differentiation cause veno-occlusive disease with immunodeficiency syndrome.
22522001 Genotyped 20 SNPs located in the SP110 gene, for the first time in a South East Asian cohort from Indonesia.Our study did not reveal any statistically significant associations between SP110 SNPs and pulmonary TB.
21536091 the results might indicate a role of SP110 variants in extrapulmonary tuberculosis rather than PTB.
21397050 This study demonstrates that genotypes and haplotypes of SP110 might be associated with susceptibility to tuberculosis in Chinese population.
21222611 identification of two proteins: the human remodeling and spacing factor 1 (RSF1) and the activating transcription factor 7 interacting protein (ATF7IP) that interact with human SP110 during the process of viral infections
21033425 Several SNPs in Sp110 are risk factors for susceptibility to tuberculosis in Chongqing Han People.
21033425 Observational study of gene-disease association. (HuGE Navigator)
20353833 Observational study of gene-disease association. (HuGE Navigator)
20332261 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20196868 Observational study of gene-disease association. (HuGE Navigator)
18187620 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including IFI41, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection
18187620 Infectious wild type HIV-1 production is enhanced by 293T cells over-expressing SP110
17883869 Sp110 expression is required for Anaplasma phagocytophilum infection and multiplication in human promyelocytic cells. A.phagocytophilum may modulate Sp110 mRNA levels to facilitate establishment of infection of human HL-60 cells.
17510920 familial hepatic veno-occlusive disease with immunodeficiency due to a homozygous truncating mutation in exon 5; SP110 c.642delC
17287948 Our finding suggests that genetic variations in the CYP19A1 gene are significantly associated with BMD at different skeletal sites in adult men, but not in women.
17149599 Observational study of gene-disease association. (HuGE Navigator)
17149599 common polymorphisms of the SP110 gene have no major effect on susceptibility to tuberculosis in the Russian population
16960008 description of a minor histocompatibility antigen created by a polymorphism in the SP110 gene; the antigenic peptide comprises 2 noncontiguous SP110 peptide segments spliced together in reverse order to that in which they occur in predicted SP110 protein
16816019 Observational study of gene-disease association. (HuGE Navigator)
16816019 Hypothesis that Sp110 variants and haplotypes might be associated with distinct phenotypes of human M tuberculosis infection is doubtful.
16803959 identified three polymorphisms that are associated with disease
16648851 reports the involvement of a Sp110 nuclear body protein in a human primary immunodeficiency and high-penetrance genetic mutations in hepatic veno-occlusive disease
15308735 Sp110b is a component of the cellular machinery that Epstein-Barr virus utilizes to enhance lytic EBV replication
15063762 Observational study of gene-disease association. (HuGE Navigator)
14559998 data suggest that Sp110b is a transcriptional cofactor negatively regulating retinoic acid receptor alpha-mediated transcription
12539042 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including IFI41, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILT      1 - 70
QLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYEWQSRDTPILLEAPTGLAEGSSLHTPLALP     71 - 140
PPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDS    141 - 210
EEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKR    211 - 280
KRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEE    281 - 350
IIDGTSEMNEGKRSQKTPSTPRRVTQGAASPGHGIQEKLQVVDKVTQRKDDSTWNSEVMMRVQKARTKCA    351 - 420
RKSRLKEKKKEKDICSSSKRRFQKNIHRRGKPKSDTVDFHCSKLPVTCGEAKGILYKKKMKHGSSVKCIR    421 - 490
NEDGTWLTPNEFEVEGKGRNAKNWKRNIRCEGMTLGELLKRKNSDECEVCCQGGQLLCCGTCPRVFHEDC    491 - 560
HIPPVEAKRMLWSCTFCRMKRSSGSQQCHHVSKTLERQMQPQDQLIRDYGEPFQEAMWLDLVKERLITEM    561 - 630
YTVAWFVRDMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFHEANDGGFWTLP               631 - 689
//

Text Mined References (45)

PMID Year Title
25006821 2014 Polymorphisms of SP110 are associated with both pulmonary and extra-pulmonary tuberculosis among the Vietnamese.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129390 2013 Identification of genetic associations of SP110/MYBBP1A/RELA with pulmonary tuberculosis in the Chinese Han population.
22700719 2012 Common variation at 6p21.31 (BAK1) influences the risk of chronic lymphocytic leukemia.
22691368 2012 SP110 gene polymorphisms and tuberculosis susceptibility: a systematic review and meta-analysis based on 10 624 subjects.
22621957 2012 Clinical, molecular, and cellular immunologic findings in patients with SP110-associated veno-occlusive disease with immunodeficiency syndrome.
22522001 2012 Polymorphisms in SP110 are not associated with pulmonary tuberculosis in Indonesians.
21536091 2011 Genetic association study suggests a role for SP110 variants in lymph node tuberculosis but not pulmonary tuberculosis in north Indians.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21397050 2011 Association of SP110 gene polymorphisms with susceptibility to tuberculosis in a Chinese population.
21222611 2011 Identification of proteins interacting with human SP110 during the process of viral infections.
21033425 2010 [Study on relation between Sp110 gene polymorphism and tuberculosis genetic susceptibility of Chongqing Han People].
20353833 2010 Degree of predicted minor histocompatibility antigen mismatch correlates with poorer clinical outcomes in nonmyeloablative allogeneic hematopoietic cell transplantation.
20332261 2010 Genetic susceptibility variants for chronic lymphocytic leukemia.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20196868 2010 Polymorphisms in IL-1beta, vitamin D receptor Fok1, and Toll-like receptor 2 are associated with extrapulmonary tuberculosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18758461 2008 A genome-wide association study identifies six susceptibility loci for chronic lymphocytic leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17883869 2007 Sp110 transcription is induced and required by Anaplasma phagocytophilum for infection of human promyelocytic cells.
17510920 2007 The first prenatal diagnosis for veno-occlusive disease and immunodeficiency syndrome, an autosomal recessive condition associated with mutations in SP110.
17287948 2007 SP110 polymorphisms are not associated with pulmonary tuberculosis in a South African population.
17149599 2007 Resequencing and association analysis of the SP110 gene in adult pulmonary tuberculosis.
16960008 2006 An antigen produced by splicing of noncontiguous peptides in the reverse order.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16816019 2006 No associations of human pulmonary tuberculosis with Sp110 variants.
16803959 2006 Variants in the SP110 gene are associated with genetic susceptibility to tuberculosis in West Africa.
16648851 2006 Mutations in the gene encoding the PML nuclear body protein Sp110 are associated with immunodeficiency and hepatic veno-occlusive disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308735 2004 Epstein-Barr virus (EBV) SM protein induces and recruits cellular Sp110b to stabilize mRNAs and enhance EBV lytic gene expression.
15063762 2004 Genetic variations in humans associated with differences in the course of hepatitis C.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559998 2003 Modulation of retinoid signaling by a cytoplasmic viral protein via sequestration of Sp110b, a potent transcriptional corepressor of retinoic acid receptor, from the nucleus.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10913195 2000 Sp110 localizes to the PML-Sp100 nuclear body and may function as a nuclear hormone receptor transcriptional coactivator.
10388521 1999 Colocalization within the nucleolus of two highly related IFN-induced human nuclear phosphoproteins with nucleolin.
7693701 1993 Molecular cloning of two new interferon-induced, highly related nuclear phosphoproteins.