Property Summary

NCBI Gene PubMed Count 55
PubMed Score 307.54
PubTator Score 128.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.400 2.9e-03
Multiple myeloma 1.537 5.1e-03
cutaneous lupus erythematosus 1.600 5.4e-04
psoriasis -2.100 2.3e-04
glioblastoma 2.400 2.1e-04
osteosarcoma -2.345 5.8e-04
posterior fossa group A ependymoma 1.900 1.7e-06
juvenile dermatomyositis 2.268 5.2e-19
non-small cell lung cancer -1.096 5.6e-11
lung cancer -4.100 1.9e-06
adult high grade glioma 2.000 3.5e-04
pilocytic astrocytoma 2.300 2.5e-08
subependymal giant cell astrocytoma 2.717 1.1e-03
lung carcinoma -1.300 1.3e-27
ulcerative colitis 1.100 1.1e-05
ovarian cancer 3.000 2.5e-07
Breast cancer -1.300 2.4e-07
pituitary cancer -1.900 1.1e-03
dermatomyositis 1.400 2.4e-02

Gene RIF (27)

PMID Text
26491169 These results suggest that high-risk human papillomavirus 31 target interferon kappa to prevent Sp100 expression and identify Sp100 as an interferon-stimulated gene with anti-human papillomavirus activity.
26057166 PML, hDaxx and Sp100 primarily act as cellular restriction factors during lytic human cytomegalovirus replication and during the dynamic process of reactivation but do not serve as key determinants for the establishment of latency.
24623443 Sp100 depletion promotes Adenovirus progeny production and early viral protein synthesis.
24194542 Sp100 repressed viral transcription and replication only during the initial stages of viral establishment, suggesting that Sp100 acts as a repressor of incoming human papillomavirus type 18 DNA.
24089549 Two regions within the N-terminal of the herpes simplex virus 1 ICP0 facilitate the degradation and dissociation of host PML and dissociation of Sp100 from ND10.
23867815 HIV-1 gp120-treated vaginal epithelial cells show downregulation of SP100 nuclear antigen (SP100) expression as compared to untreated control
23830076 The results suggest that hantavirus infection interferes with DAXX-mediated apoptosis, and expression of interferon-activated Sp100 and ISG-20 proteins may indicate intracellular intrinsic antiviral attempts.
23485562 Sp100 is recruited to activated arrays in cells expressing the herpes simplex virus type 1 E3 ubiquitin ligase, ICP0, which degrades all Sp100 isoforms except unsumoylated Sp100A.
23221561 Authors conclude that several ND10 components, including Daxx, the promyelocytic leukemia (PML) protein, and Sp100 cooperate in an additive manner to regulate herpes simplex virus type 1 and human cytomegalovirus infection.
22419217 SP100 and Adeno-associated virus 2 Rep78 are both located in the nucleolus, which provides the spatial possibility for their interaction.
22278248 Herpesvirus saimiri tegument protein specifically degraded the cellular ND10 component Sp100.
22086178 These findings expand our knowledge of both Sp100 and Cdc20 as well as their role in ubiquitination.
21880768 These findings indicate that thehuman herpesvirus 5 IE1-dependent loss of human Sp100 proteins during virus infection may represent an important requirement for efficient viral growth.
21734036 Taken together, these data provide evidence that Sp100 is the first ND10-related factor identified that not only possesses the potential to restrict the initial stage of infection but also inhibits cytomegalovirus replication during the late phase.
21471311 Sp100 counteract human cytomegalovirus infection via the repression of viral immediate-early gene expression.
21383994 Endogenous Sp100 may interact with PhiC31 integrase and inhibit the efficiency of PhiC31 integrase-mediated recombination.
21274506 SP100 expression reduces malignancy of brain tumors
20512085 Sp100 has a role in the initiation and progression of tumorgenesis
20130140 During interphase PML-NBs adopt a spherical organization characterized by the assembly of PML and Sp100 proteins into patches within a 50- to 100-nm-thick shell.
19279115 Sp100 isoforms suppress immediate-early HSV-1 proteins at the promoter level and that IFN changes the splicing pattern of the Sp100 transcript to the suppressing Sp100C isoform.
16873258 Repressive Sp100 isoforms B, C, and HMG are an essential part of the IFN-beta-mediated suppression of ICP0 expression.
16415175 Observational study of gene-disease association. (HuGE Navigator)
16177824 EBNA-LP interacts with the promyelocytic leukemia nuclear body (PML NB)-associated protein Sp100 and displaces Sp100 and heterochromatin protein 1alpha (HP1alpha) from PML NBs.
15592518 Genes that are negatively regulated by ETS1 and upregulated by SP100 have antimigratory or antiangiogenic properties.
15247905 SP100 modulates ETS1-dependent biological processes
14647468 a novel function for Sp100 as a coactivator for HIPK2-mediated p53 activation.
11909962 Sp100 interacts with ETS-1 and stimulates its transcriptional activity.

AA Sequence

MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKK      1 - 70
TFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLPVLEALFSDVNMQEYPDLIHI     71 - 140
YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCE    141 - 210
TEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELH    211 - 280
NHGIQINSCSVRLVDIKKEKPFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRS    281 - 350
EPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS    351 - 420
GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQPQEPENKKCSC    421 - 490
VMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHRSKVNGLQRGRKKDRPRKHLT    491 - 560
LNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINFKQSELPVTCGEVKGTLYKERFKQGTSKKCI    561 - 630
QSEDKKWFTPREFEIEGDRGASKNWKLSIRCGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEE    631 - 700
HKKKNPDASVKFSEFLKKCSETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPK    701 - 770
RPPLAFFLFCSEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKG    771 - 840
KPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK                                   841 - 879
//

Text Mined References (67)

PMID Year Title
26491169 2015 Interferon Kappa Inhibits Human Papillomavirus 31 Transcription by Inducing Sp100 Proteins.
26057166 2015 Contribution of the Major ND10 Proteins PML, hDaxx and Sp100 to the Regulation of Human Cytomegalovirus Latency and Lytic Replication in the Monocytic Cell Line THP-1.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24623443 2014 Sp100 isoform-specific regulation of human adenovirus 5 gene expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24194542 2013 Sp100 provides intrinsic immunity against human papillomavirus infection.
24089549 2013 Two overlapping regions within the N-terminal half of the herpes simplex virus 1 E3 ubiquitin ligase ICP0 facilitate the degradation and dissociation of PML and dissociation of Sp100 from ND10.
23907639 2013 Retraction: Sp100 as a potent tumor suppressor: accelerated senescence and rapid malignant transformation of human fibroblasts through modulation of an embryonic stem cell program.
23830076 2013 Death-domain associated protein-6 (DAXX) mediated apoptosis in hantavirus infection is counter-balanced by activation of interferon-stimulated nuclear transcription factors.
23485562 2013 Sp100A promotes chromatin decondensation at a cytomegalovirus-promoter-regulated transcription site.
23221561 2013 Components of promyelocytic leukemia nuclear bodies (ND10) act cooperatively to repress herpesvirus infection.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22419217 2013 Role and fate of SP100 protein in response to Rep-dependent nonviral integration system.
22278248 2012 Herpesvirus saimiri antagonizes nuclear domain 10-instituted intrinsic immunity via an ORF3-mediated selective degradation of cellular protein Sp100.
22086178 2011 Cdc20 mediates D-box-dependent degradation of Sp100.
21880768 2011 Human cytomegalovirus infection causes degradation of Sp100 proteins that suppress viral gene expression.
21734036 2011 Evidence for a dual antiviral role of the major nuclear domain 10 component Sp100 during the immediate-early and late phases of the human cytomegalovirus replication cycle.
21471311 2011 Human cytomegalovirus immediate-early gene expression is restricted by the nuclear domain 10 component Sp100.
21383994 2011 Sp100 interacts with phage ?C31 integrase to inhibit its recombination activity.
21274506 2011 SP100 reduces malignancy of human glioma cells.
21118961 2010 Sp100 as a potent tumor suppressor: accelerated senescence and rapid malignant transformation of human fibroblasts through modulation of an embryonic stem cell program.
20512085 2010 Low expression of Sp100 in laryngeal cancer: correlation with cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20130140 2010 Three-dimensional organization of promyelocytic leukemia nuclear bodies.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19279115 2009 Differential functions of interferon-upregulated Sp100 isoforms: herpes simplex virus type 1 promoter-based immediate-early gene suppression and PML protection from ICP0-mediated degradation.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17332504 2007 Dynamic regulation of p53 subnuclear localization and senescence by MORC3.
17245429 2007 FLASH links the CD95 signaling pathway to the cell nucleus and nuclear bodies.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17000644 2006 Distinct and overlapping sets of SUMO-1 and SUMO-2 target proteins revealed by quantitative proteomics.
16873258 2006 Differential role of Sp100 isoforms in interferon-mediated repression of herpes simplex virus type 1 immediate-early protein expression.
16415175 2006 High throughput SNP and expression analyses of candidate genes for non-syndromic oral clefts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177824 2005 Mediation of Epstein-Barr virus EBNA-LP transcriptional coactivation by Sp100.
15882967 2005 The mammalian heterochromatin protein 1 binds diverse nuclear proteins through a common motif that targets the chromoshadow domain.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15767676 2005 Suppression of alternative lengthening of telomeres by Sp100-mediated sequestration of the MRE11/RAD50/NBS1 complex.
15592518 2005 SP100 inhibits ETS1 activity in primary endothelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247905 2004 SP100 expression modulates ETS1 transcriptional activity and inhibits cell invasion.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647468 2003 Sp100 is important for the stimulatory effect of homeodomain-interacting protein kinase-2 on p53-dependent gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470659 2002 Recruitment of NBS1 into PML oncogenic domains via interaction with SP100 protein.
11909962 2002 Sp100 interacts with ETS-1 and stimulates its transcriptional activity.
11574059 2001 Molecular archeology of an SP100 splice variant revisited: dating the retrotranscription and Alu insertion events.
11313457 2001 Common properties of nuclear body protein SP100 and TIF1alpha chromatin factor: role of SUMO modification.
10921892 2000 Regulation of matrix attachment region-dependent, lymphocyte-restricted transcription through differential localization within promyelocytic leukemia nuclear bodies.
10766566 2000 Back to the roots of a new exon--the molecular archaeology of a SP100 splice variant.
10212234 1999 The nuclear dot protein sp100, characterization of domains necessary for dimerization, subcellular localization, and modification by small ubiquitin-like modifiers.
9973607 1999 Splice variants of the nuclear dot-associated Sp100 protein contain homologies to HMG-1 and a human nuclear phosphoprotein-box motif.
9636147 1998 Chromatin components as part of a putative transcriptional repressing complex.
9636146 1998 Interaction of SP100 with HP1 proteins: a link between the promyelocytic leukemia-associated nuclear bodies and the chromatin compartment.
9412458 1997 Evidence for covalent modification of the nuclear dot-associated proteins PML and Sp100 by PIC1/SUMO-1.
9230084 1997 Cellular localization, expression, and structure of the nuclear dot protein 52.
8810287 1996 The interferon (IFN)-stimulated gene Sp100 promoter contains an IFN-gamma activation site and an imperfect IFN-stimulated response element which mediate type I IFN inducibility.
8695863 1996 LYSP100-associated nuclear domains (LANDs): description of a new class of subnuclear structures and their relationship to PML nuclear bodies.
2258622 1990 Isolation and characterization of cDNA encoding a human nuclear antigen predominantly recognized by autoantibodies from patients with primary biliary cirrhosis.