Property Summary

NCBI Gene PubMed Count 57
PubMed Score 321.27
PubTator Score 128.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 2.000 3.5e-04
Astrocytoma, Pilocytic 2.300 1.3e-08
Breast cancer -1.300 2.4e-07
cutaneous lupus erythematosus 1.300 2.5e-03
dermatomyositis 1.200 3.8e-02
ependymoma 1.700 1.6e-05
glioblastoma 1.700 7.1e-05
juvenile dermatomyositis 2.268 5.2e-19
lung cancer -2.600 5.7e-04
lung carcinoma -1.300 1.3e-27
Multiple myeloma 1.537 5.1e-03
non-small cell lung cancer -1.096 5.6e-11
osteosarcoma -1.895 7.9e-03
ovarian cancer -1.100 2.5e-03
pituitary cancer -1.900 1.1e-03
psoriasis -2.100 2.3e-04
Rheumatoid arthritis 1.400 2.9e-03
subependymal giant cell astrocytoma 2.568 3.6e-03
ulcerative colitis 1.100 1.1e-05

Protein-protein Interaction (1)

PDB (118)

Gene RIF (29)

AA Sequence

MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKK      1 - 70
TFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLPVLEALFSDVNMQEYPDLIHI     71 - 140
YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCE    141 - 210
TEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELH    211 - 280
NHGIQINSCSVRLVDIKKEKPFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRS    281 - 350
EPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS    351 - 420
GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQPQEPENKKCSC    421 - 490
VMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHRSKVNGLQRGRKKDRPRKHLT    491 - 560
LNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINFKQSELPVTCGEVKGTLYKERFKQGTSKKCI    561 - 630
QSEDKKWFTPREFEIEGDRGASKNWKLSIRCGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEE    631 - 700
HKKKNPDASVKFSEFLKKCSETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPK    701 - 770
RPPLAFFLFCSEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKG    771 - 840
KPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK                                   841 - 879
//

Text Mined References (70)

PMID Year Title