Property Summary

NCBI Gene PubMed Count 26
PubMed Score 30.11
PubTator Score 32.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.400 4.2e-02
cystic fibrosis 3.871 1.3e-07
medulloblastoma, large-cell 2.800 6.8e-05
autosomal dominant Emery-Dreifuss muscul... 1.202 1.7e-02
juvenile dermatomyositis 1.097 2.9e-05
acute quadriplegic myopathy 1.929 9.9e-04
non-small cell lung cancer -2.633 1.3e-16
intraductal papillary-mucinous adenoma (... -2.500 4.9e-03
intraductal papillary-mucinous carcinoma... -4.100 8.0e-05
psoriasis 1.600 4.1e-154
invasive ductal carcinoma -2.000 9.1e-04
breast carcinoma -1.400 4.4e-15
Breast cancer -1.800 6.6e-08
ductal carcinoma in situ -1.200 1.9e-03
ulcerative colitis 1.200 1.3e-03
ovarian cancer 1.100 1.1e-02
pituitary cancer -2.800 2.8e-08

Protein-protein Interaction (1)

Gene RIF (19)

PMID Text
26944317 the HMG-box is a key domain of SOX7 for negatively regulating the Wnt/beta-catenin signaling pathway when functioning as a tumor suppressor in a glioma.
25940713 The results provided unequivocal evidence for a novel tumor suppressor role of SOX7 in acute myeloid leukemia
25407488 Ectopic expression of miR-492 led to downregulation of SOX7 protein.
25297608 The expression of SOX7 correlates with tumor progression as a tumor suppressor, possibly through the Wnt/beta-catenin signaling pathway in ovarian cancers, suggesting that SOX7 may be a promising prognostic marker.
25073511 Low SOX7 expression is associated with hepatocellular carcinoma.
24816720 SOX7 plays an important inhibitory role in hepatocarcinogenesis, and might be a novel target for hepatocellular carcinoma therapy.
24788044 Decreased expression of Sox7 correlates with the upregulation of the Wnt/beta-catenin signaling pathway and the poor survival of gastric cancer patients.
24558429 miR-184 represents a potential onco-miR and plays an important role in HCC progression by suppressing SOX7 expression
24012678 SOX7 acts as a tumor suppressor in breast cancer.
23557216 SOX7 is a novel tumor suppressor gene silenced in the majority of NSCLC samples.
23295859 Sox7 is a negative regulator of Wnt/beta-catenin signaling pathway through impeding the transcriptional machinery of beta-catenin/TCF/LEF-1 transcriptional complex, and the loss of expression may be involved in the pathogenesis of endometrial cancer.
22777918 Association of SOX7 protein expression with clinical outcomes was evaluated. SOX7 mRNA expression was significantly down-regulated in lung adenocarcinoma compared with matched adjacent normal tissues.
22706399 The methylation of the CpG island of the SOX7 gene can be used as a predictive factor for the development and prognosis of myelodysplastic syndrome patients.
22171135 Data show that SOX7 is upregulated by aspirin and is involved in aspirin-mediated growth inhibition of human colorectal cancer SW480 cells.
19108950 SOX7, down-regulated in colorectal cancer, induces apoptosis and inhibits proliferation of colorectal cancer cells.
18940723 stable expression induces a stable expandable extra embryonic endoderm phenotype in hESCs
18819930 Sox7 is a tumor suppressor that functions as an independent checkpoint for beta-catenin transcriptional activity. Inactivation of Sox7 could promote the development of a majority of colorectal tumors and approximately half of prostate tumors.
18682240 stable endoderm progenitors can be established from human ES cells by constitutive expression of SOX7 producing extraembryonic endoderm progenitors
11691915 gene expression, chromosome mapping, transactivation, interference with Wnt signaling

AA Sequence

MASLLGAYPWPEGLECPALDAELSDGQSPPAVPRPPGDKGSESRIRRPMNAFMVWAKDERKRLAVQNPDL      1 - 70
HNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRVDPGFLLSSLSR     71 - 140
DQNALPEKRSGSRGALGEKEDRGEYSPGTALPSLRGCYHEGPAGGGGGGTPSSVDTYPYGLPTPPEMSPL    141 - 210
DVLEPEQTFFSSPCQEEHGHPRRIPHLPGHPYSPEYAPSPLHCSHPLGSLALGQSPGVSMMSPVPGCPPS    211 - 280
PAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMA    281 - 350
LSGHVPVSQVTPTGPTETSLISVLADATATYYNSYSVS                                    351 - 388
//

Text Mined References (27)

PMID Year Title
26944317 2016 SOX7 is associated with the suppression of human glioma by HMG-box dependent regulation of Wnt/?-catenin signaling.
25940713 2015 Suppression of SOX7 by DNA methylation and its tumor suppressor function in acute myeloid leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
25407488 2015 MiR-492 contributes to cell proliferation and cell cycle of human breast cancer cells by suppressing SOX7 expression.
25297608 2014 Reduced expression of SOX7 in ovarian cancer: a novel tumor suppressor through the Wnt/?-catenin signaling pathway.
25073511 2014 miR-24 promotes the proliferation and invasion of HCC cells by targeting SOX7.
24816720 2014 The suppressive role of SOX7 in hepatocarcinogenesis.
24788044 2014 Decreased expression of Sox7 correlates with the upregulation of the Wnt/?-catenin signaling pathway and the poor survival of gastric cancer patients.
24558429 2014 Mir-184 post-transcriptionally regulates SOX7 expression and promotes cell proliferation in human hepatocellular carcinoma.
24012678 2013 The regulation of SOX7 and its tumor suppressive role in breast cancer.
23557216 2013 SOX7 is down-regulated in lung cancer.
23295859 2012 Down-regulation of Sox7 is associated with aberrant activation of Wnt/b-catenin signaling in endometrial cancer.
22777918 2012 Decreased expression of SOX7 is correlated with poor prognosis in lung adenocarcinoma patients.
22706399 2012 Methylation of the CpG island near SOX7 gene promoter is correlated with the poor prognosis of patients with myelodysplastic syndrome.
22171135 2011 SOX7 is involved in aspirin-mediated growth inhibition of human colorectal cancer cells.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
19108950 2009 SOX7, down-regulated in colorectal cancer, induces apoptosis and inhibits proliferation of colorectal cancer cells.
18940723 2008 Expandable endodermal progenitors: new tools to explore endoderm and its derivatives.
18819930 2008 Sox7 Is an independent checkpoint for beta-catenin function in prostate and colon epithelial cells.
18682240 2008 Establishment of endoderm progenitors by SOX transcription factor expression in human embryonic stem cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11691915 2001 SOX7 transcription factor: sequence, chromosomal localisation, expression, transactivation and interference with Wnt signalling.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.