Property Summary

NCBI Gene PubMed Count 61
PubMed Score 100.64
PubTator Score 60.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.2
Kidney cancer 2548 0.0 0.5
pancreatic cancer 2322 0.0 0.6
Disease Target Count Z-score Confidence
Systemic scleroderma 57 0.0 2.7

Expression

  Differential Expression (16)

Disease log2 FC p
Alzheimer's disease 1.300 2.7e-02
ductal carcinoma in situ -2.500 1.8e-04
ependymoma 1.400 2.2e-06
group 4 medulloblastoma -1.100 2.2e-02
interstitial cystitis -1.100 6.5e-03
intraductal papillary-mucinous adenoma (... -1.500 1.5e-03
intraductal papillary-mucinous carcinoma... -1.400 2.9e-03
invasive ductal carcinoma -2.900 6.7e-04
lung cancer -1.100 3.3e-02
medulloblastoma, large-cell -1.800 4.1e-03
non-small cell lung carcinoma -1.100 7.1e-25
osteosarcoma 1.110 4.9e-02
ovarian cancer 1.100 9.1e-03
Pick disease 2.100 1.1e-06
pituitary cancer -1.200 2.3e-04
psoriasis -1.600 1.9e-35

Protein-protein Interaction (5)

Gene RIF (37)

AA Sequence

MLTDPDLPQEFERMSSKRPASPYGEADGEVAMVTSRQKVEEEESDGLPAFHLPLHVSFPNKPHSEEFQPV      1 - 70
SLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSSTSPQKAEEGGRQSGESLSSTALGTPERRKGSLA     71 - 140
DVVDTLKQRKMEELIKNEPEETPSIEKLLSKDWKDKLLAMGSGNFGEIKGTPESLAEKERQLMGMINQLT    141 - 210
SLREQLLAAHDEQKKLAASQIEKQRQQMELAKQQQEQIARQQQQLLQQQHKINLLQQQIQVQGQLPPLMI    211 - 280
PVFPPDQRTLAAAAQQGFLLPPGFSYKAGCSDPYPVQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAAMQ    281 - 350
VSPGGKLPGIPQGNLGAAVSPTSIHTDKSTNSPPPKSKDEVAQPLNLSAKPKTSDGKSPTSPTSPHMPAL    351 - 420
RINSGAGPLKASVPAALASPSARVSTIGYLNDHDAVTKAIQEARQMKEQLRREQQVLDGKVAVVNSLGLN    421 - 490
NCRTEKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLSGDSDGSAGVSESRIYRESRGRGSNEPHIKRPM    491 - 560
NAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPK    561 - 630
RTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVGQQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSS    631 - 700
SPEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYGSDSENHIAGQAN           701 - 763
//

Text Mined References (67)

PMID Year Title