Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.92
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Ocular hypertension 27 3.013 1.5

Expression

Gene RIF (2)

PMID Text
26330328 SOX30 expression represents an important prognostic factor for survival time in lung adenocarcinoma patients.
25435374 Blockade of p53 attenuates the tumor inhibition of SOX30.

AA Sequence

MERARPEPPPQPRPLRPAPPPLPVEGTSFWAAAMEPPPSSPTLSAAASATLASSCGEAVASGLQPAVRRL      1 - 70
LQVKPEQVLLLPQPQAQNEEAAASSAQARLLQFRPDLRLLQPPTASDGATSRPELHPVQPLALHVKAKKQ     71 - 140
KLGPSLDQSVGPRGAVETGPRASRVVKLEGPGPALGYFRGDEKGKLEAEEVMRDSMQGGAGKSPAAIREG    141 - 210
VIKTEEPERLLEDCRLGAEPASNGLVHGSAEVILAPTSGAFGPHQQDLRIPLTLHTVPPGARIQFQGAPP    211 - 280
SELIRLTKVPLTPVPTKMQSLLEPSVKIETKDVPLTVLPSDAGIPDTPFSKDRNGHVKRPMNAFMVWARI    281 - 350
HRPALAKANPAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPRPGKRKRFPLSV    351 - 420
SNVFSGTTQNIISTNPTTVYPYRSPTYSVVIPSLQNPITHPVGETSPAIQLPTPAVQSPSPVTLFQPSVS    421 - 490
SAAQVAVQDPSLPVYPALPPQRFTGPSQTDTHQLHSEATHTVKQPTPVSLESANRISSSASTAHARFATS    491 - 560
TIQPPREYSSVSPCPRSAPIPQASPIPHPHVYQPPPLGHPATLFGTPPRFSFHHPYFLPGPHYFPSSTCP    561 - 630
YSRPPFGYGNFPSSMPECLSYYEDRYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSYYNSH    631 - 700
SHSGEENLNPVPQLDIGTLENVFTAPTSTPSSIQQVNVTDSDEEEEEKVLRDL                     701 - 753
//

Text Mined References (18)

PMID Year Title
26330328 2015 High expression of SOX30 is associated with favorable survival in human lung adenocarcinoma.
25609838 2015 Combining RNA and protein profiling data with network interactions identifies genes associated with spermatogenesis in mouse and human.
25435374 2015 SOX30, a novel epigenetic silenced tumor suppressor, promotes tumor cell apoptosis by transcriptional activating p53 in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23872309 2013 Comprehensive whole-genome sequencing of an early-stage primary myelofibrosis patient defines low mutational burden and non-recurrent candidate genes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21143990 2010 Characterization, phylogeny, alternative splicing and expression of Sox30 gene.
18436822 2008 Gene expression profiles of human trabecular meshwork cells induced by triamcinolone and dexamethasone.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16571642 2006 The human cumulus--oocyte complex gene-expression profile.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15019997 2004 Origin and diversity of the SOX transcription factor gene family: genome-wide analysis in Fugu rubripes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11678506 2000 HMG-box sequences from microbats homologous to the human SOX30 HMG-box.
10359848 1999 Identification of a novel Sry-related gene and its germ cell-specific expression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.