Property Summary

NCBI Gene PubMed Count 33
PubMed Score 66.30
PubTator Score 39.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
non-small cell lung cancer -1.627 9.1e-15
interstitial cystitis 1.200 3.8e-03
adult high grade glioma -1.100 1.0e-02
atypical teratoid/rhabdoid tumor -1.300 2.5e-05
group 4 medulloblastoma -1.300 4.0e-04
invasive ductal carcinoma -1.200 4.4e-02

Gene RIF (20)

PMID Text
26588701 GLI1 and GLI2, but not GLI3 are involved in the regulation of SOX18 gene expression in cervical carcinoma cell lines.
26573263 The downregulation of SOX18 was found to significantly inhibit cell adhesion and invasion.
26396173 NKD2 inhibits SOX18 and MMP-2,7,9 expression and suppresses BGC823 cell xenograft growth. NKD2 methylation may serve as a poor prognostic and chemo-sensitive marker in human gastric cancer. NKD2 impedes gastric cancer metastasis by inhibiting SOX18.
26151573 we demonstrated that upregulation of SOX18 was associated with a poor outcome in hepatocellular carcinoma patients
26148450 The genetic finding of a pathogenic SOX18 mutation enabled the diagnosis of the rare hypotrichosis-lymphedema-telangiectasia syndrome in our patient.
25310193 SOX18 may be involved in the progression of Non small cell lung cancer.
24697860 A new, autosomal dominant condition combining hypotrichosis-lymphedema-telangiectasia syndrome with renal defects is associated with a novel truncating mutation in the SOX18 gene.
24460943 SOX18wt has potent trans-activation proper- ties, while SOX18DN displayed dominant-negative effect.
24269235 The repression of Sox18 and its target genes may lead to altered formation of vessels in inflamed settings.
24065215 Data suggest that SOX18 transcription factor expression may serve as a marker for a poor prognosis in invasive ductal breast carcinoma.
22292085 The identification of MMP7 as a direct SOX18 target gene as well as other potential candidates including guidance molecules provides a molecular basis for the proposed function of this transcription factor in the regulation of vessel formation.
22018271 Heterogeneous methylation in the promoter region of SOX18 was associated with cancer progression in non-small cell lung cancer.
21796627 of the 679 gastric cancer cases, 177 (26.1%) were positive for SOX 18 expression in their tumor stroma, and the frequencies of both lymphovascular invasion and lymph node metastases were higher in the SOX 18 positive than in the negative group.
18564921 Observational study of gene-disease association. (HuGE Navigator)
18564920 Observational study of gene-disease association. (HuGE Navigator)
18496767 Transcription factors Sp3, ZBP-89 and NF-Y are capable of binding to the SOX18 promoter region.
18065521 an obligatory role for SOX-18 in the regulation of claudin-5 gene expression in an endothelial-specific and cell density-dependent manner is established
16882943 Overexpression of wild-type SOX18 promoted capillary tube formation of HUVECs in vitro, whereas expression of dominant-negative SOX18 impaired tube formation of HUVECs and the migration of MCF-7 cells via the disruption of the actin cytoskeleton.
16179596 SOX18 is involved in vascular cell growth and this transcription factor may play a role in atherosclerosis
12740761 Mutations in SOX18 underlie recessive and dominat forms of hypertrichosis-lymphedema- telangiectasis/

AA Sequence

MQRSPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLS      1 - 70
PAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAER     71 - 140
LRVQHLRDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPPQPPPEPFPAASGSARAFRELPPLGAEFDGL    141 - 210
GLPTPERSPLDGLEPGEAAFFPPPAAPEDCALRPFRAPYAPTELSRDPGGCYGAPLAEALRTAPPAAPLA    211 - 280
GLYYGTLGTPGPYPGPLSPPPEAPPLESAEPLGPAADLWADVDLTEFDQYLNCSRTRPDAPGLPYHVALA    281 - 350
KLGPRAMSCPEESSLISALSDASSAVYYSACISG                                        351 - 384
//

Text Mined References (34)

PMID Year Title
26588701 2015 SOX18 Is a Novel Target Gene of Hedgehog Signaling in Cervical Carcinoma Cell Lines.
26573263 2016 SOX18 knockdown suppresses the proliferation and metastasis, and induces the apoptosis of osteosarcoma cells.
26396173 2015 Silencing NKD2 by promoter region hypermethylation promotes gastric cancer invasion and metastasis by up-regulating SOX18 in human gastric cancer.
26151573 2015 Knockdown of SOX18 inhibits the proliferation, migration and invasion of hepatocellular carcinoma cells.
26148450 2016 Aortic Dilatation Associated With a De Novo Mutation in the SOX18 Gene: Expanding the Clinical Spectrum of Hypotrichosis-Lymphedema-Telangiectasia Syndrome.
25310193 2015 Prognostic significance of SOX18 expression in non-small cell lung cancer.
24697860 2015 Hypotrichosis-lymphedema-telangiectasia-renal defect associated with a truncating mutation in the SOX18 gene.
24460943 2013 Construction and functional analysis of novel dominant-negative mutant of human SOX18 protein.
24269235 2013 TNF?-induced down-regulation of Sox18 in endothelial cells is dependent on NF-?B.
24065215 2013 Impact of SOX18 expression in cancer cells and vessels on the outcome of invasive ductal breast carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22292085 2012 The transcription factor SOX18 regulates the expression of matrix metalloproteinase 7 and guidance molecules in human endothelial cells.
22018271 2011 Heterogeneity and degree of TIMP4, GATA4, SOX18, and EGFL7 gene promoter methylation in non-small cell lung cancer and surrounding tissues.
21796627 2012 The lymphangiogenic factor SOX 18: a key indicator to stage gastric tumor progression.
18564921 2008 Candidate gene analysis in primary lymphedema.
18564920 2008 HGF and MET mutations in primary and secondary lymphedema.
18496767 2009 ZBP-89 and Sp3 down-regulate while NF-Y up-regulates SOX18 promoter activity in HeLa cells.
18065521 2008 SOX-18 controls endothelial-specific claudin-5 gene expression and barrier function.
16882943 2006 Effect of disrupted SOX18 transcription factor function on tumor growth, vascularization, and endothelial development.
16179596 2005 Transcription factor SOX18 is expressed in human coronary atherosclerotic lesions and regulates DNA synthesis and vascular cell growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12740761 2003 Mutations in the transcription factor gene SOX18 underlie recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194848 2002 Twenty pairs of sox: extent, homology, and nomenclature of the mouse and human sox transcription factor gene families.
12165811 2002 Expression of human SOX18 in normal tissues and tumors.
12100890 2002 Matching SOX: partner proteins and co-factors of the SOX family of transcriptional regulators.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11554755 2001 SOX18 directly interacts with MEF2C in endothelial cells.
11130989 2000 Structure, mapping, and expression of human SOX18.
10858556 2000 The human SOX18 gene: cDNA cloning and high resolution mapping.
10807548 2000 cDNA cloning, tissue expression, and chromosome mapping of human homolog of SOX18.
7665083 1995 Sequence and expression of Sox-18 encoding a new HMG-box transcription factor.
1614875 1992 A conserved family of genes related to the testis determining gene, SRY.