Property Summary

NCBI Gene PubMed Count 58
PubMed Score 199.81
PubTator Score 112.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
osteosarcoma -2.190 1.7e-03
non-small cell lung cancer -2.656 1.9e-25
intraductal papillary-mucinous adenoma (... -1.600 5.4e-04
intraductal papillary-mucinous carcinoma... -1.400 1.6e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.4e-02
lung cancer -1.800 1.3e-04
breast carcinoma -1.900 7.2e-06
fibroadenoma -2.300 2.3e-03
interstitial cystitis 1.200 3.0e-03
aldosterone-producing adenoma -1.139 1.8e-02
lung adenocarcinoma -2.200 6.5e-12
psoriasis -1.500 6.0e-08
non-inflammatory breast cancer -1.600 4.4e-04
ductal carcinoma in situ -1.100 6.9e-03
invasive ductal carcinoma -1.800 1.5e-03
ovarian cancer 4.300 1.0e-10

Protein-protein Interaction (6)

Gene RIF (47)

PMID Text
26463399 high expression of the Sox17 associated pathway in medium and small arteries indicates that Brain arteriovenous malformation vessels are intrinsically active
26411902 Knockdown of OCT4 during differentiation inhibits mesendoderm formation and removal of the H3K27me3 mark from the SOX17 promoter, suggesting that OCT4 acts to induce removal of the Polycomb2 complex.
25971583 Decreased expression of SOX17 is associated with tumor progression in breast cancer.
25953442 SOX17 might play a role in the development of Ovarian Cancer, and may be a therapeutic target in OC.
25868860 SOX17 demethylation induced miR-371-5p expression and consequently suppressed its direct target SOX2. A novel mechanism of the SOX17/miR-371-5p/SOX2 axis is involved in the regulation of EMT, stemness and metastasis.
25789956 promoter methylation may play an important role in breast cancer progression and could be used as a prognostic biomarker to identify patients at risk of developing metastasis or recurrence after mastectomy
25674225 In this study, oligodendroglioma patients with 1p/19q LOH and Sox17 protein expression had a better prognosis.
25596186 Human intracranial aneurysm samples showed reduced Sox17 expression and impaired endothelial integrity.
25543152 SOX17 is the key regulator of human primordial germ cells-like cells specification, whereas BLIMP1 represses endodermal and other somatic genes during hPGCLC specification.
25310020 Decreased Sox17 expression is correlated with melanoma progression, an unfavorable survival of melanoma patients and is an independent molecular prognostic factor for melanoma.
25291942 Hypermethylation of SOX17 promoter may be one of the early events in the development of myelodysplatic syndrome and predicts poor prognosis.
25106407 Low Sox17 expression is associated with hepatocellular carcinoma.
25053769 Possible association of SOX-17 and RBBP8 with brain arteriovenous malformations, genes involved in cell cycle progression, deserves further investigation
24407731 Low SOX17 expression is associated with esophageal cancer progression.
23999170 Immunofluorescence analysis of human pancreatic tissue arrays revealed the presence of tuft cells in metaplasia and early-stage tumors, along with SOX17 expression, consistent with a biliary phenotype.
23918253 In multiple sclerosis tissue, Sox17 was primarily detected in actively demyelinating lesions and periplaque white matter.
23813959 Experimental confirmation of miRNA-mRNA interactions established a critical role of miR-200a in regulating both EMT and definitive endoderm formation, through direct repression of ZEB2 and SOX17, during early stage differentiation.
23474492 recombinant Sox17 mediates modulation of the Wnt pathway through changes in beta-catenin, SFRP1 and Wnt/Frizzled expression.
23403728 Overall survival of patients with gastric cancer was found to be significantly associated with SOX17 promoter methylation.
23241958 findings establish Sox17 as a key regulator of tumor angiogenesis and tumor progression.
23169777 SOX17 plays a key role in priming hemogenic potential in endothelial cells, thereby regulating hematopoietic development from stem cells.
23136251 SOX17 promoter is highly methylated in primary breast tumors, in CTCs isolated from patients with breast cancer, and in corresponding cfDNA samples
23061670 after electrostatic interactions attract Sox17 to DNA, Asn73, Ser99, and Trp106 form hydrogen bonds with DNA, Arg70, Lys80, Arg83, His94, and Asn95 on Sox17 undergo conformational changes and form hydrogen bonds with DNA
23044318 SOX17 was frequently methylated in human PTC. Loss of SOX17 expression was induced by promoter region hypermethylation. SOX17 inhibited thyroid cancer proliferation. Methylation of SOX17 activated the Wnt signaling pathway in human thyroid cancer.
22961961 provided further evidence to support the previously reported association of intracranial aneurysm with single nucleotide polymorphism in SOX17
22921431 SOX17 promoter region is frequently methylated in esophageal cancer and in a progression tendency during esophageal carcinogenesis.
22846201 SOX17 acts as a Wnt signaling inhibitor.
22348788 New sequence variations in SOX17 were identified but all correspond to nonpathogenic variants, suggesting that SOX17 is not involved in UHL phenotype
22161215 silencing of Sox17 occurs frequently in early gastric cancer
21957254 Downstream targets of Sox17 define signaling pathways and molecular mechanisms in oligodendrocyte progenitor cells that are regulated by Sox17 during cell cycle exit and differentiation in oligodendrocyte development.
21760905 A stage-specific transduction of SOX17 in the primitive endoderm or mesendoderm promotes directive extraembryonic endoderm or definitive endoderm differentiation by SOX17 transduction, respectively.
21514720 Sox17 prominently contributes to gastric cancer progression through regulating proliferation and cell cycle, indicating a novel diagnosis and prognosis biomarker as well as a potential therapeutic target in gastric cancer
21457403 Sox17 might be a key transcription factor controlling CD133 expression, and that it might also play a role in the control of gastric tumor progression.
21362573 SOX17(+)-human embryonic stem cell progeny expressed endodermal markers.
21305474 Data show that down-regulated by Sox17 expressing HepG2 cells is a set of genes that are expressed in the developing liver, suggesting that one function of Sox17 is the repression of liver gene expression.
20960469 These data indicate a role of SOX17 in human kidney and urinary tract development and implicate the SOX17-p.Y259N mutation as a causative factor in congenital anomalies of the kidney and the urinary tract .
20716954 SOX17 negatively regulates canonical WNT/beta-catenin signaling pathway and inhibits human HCC cells growth
20364137 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19736317 Data reveal a molecular Oct4-, Sox2- and Sox17-mediated mechanism that disrupts the stem cell microenvironment favoring pluripotency to provide an endodermal environment in which cell lineage is determined and commits the cells to a cardiogenic fate.
19549530 Sox17 protects benign tumors from malignant progression at an early stage of tumorigenesis, and down-regulation of Sox17 contributes to malignant progression through promotion of Wnt activity.
19369635 SOX2 and SOX17 expression patterns can distinguish between seminoma and embryonal carcinoma, and this distinction may be diagnostically useful.
19301122 Sox17 may be a valuable biomarker for the study of breast cancer carcinogenesis and progression.
18940723 stable expression induces a stable expandable definitive endoderm phenotype in hESCs
18682240 stable endoderm progenitors can be established from human ES cells by constitutive expression of SOX17 producing definitive endoderm progenitors
18564921 Observational study of gene-disease association. (HuGE Navigator)
18523156 SOX17-Chromatin immunoprecipitation identified zinc finger protein 202 (Zfp202) as a direct target of SOX17 during endoderm differentiation of F9 embryonal carcinoma cells.
18413743 SOX17 silencing due to promoter hypermethylation is an early event during tumorigenesis and may contribute to aberrant activation of Wnt signaling in colorectal cancer.

AA Sequence

MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGESRIRR      1 - 70
PMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPR     71 - 140
RRKQVKRLKRVEGGFLHGLAEPQAAALGPEGGRVAMDGLGLQFPEQGFPAGPPLLPPHMGGHYRDCQSLG    141 - 210
APPLDGYPLPTPDTSPLDGVDPDPAFFAAPMPGDCPAAGTYSYAQVSDYAGPPEPPAGPMHPRLGPEPAG    211 - 280
PSIPGLLAPPSALHVYYGAMGSPGAGGGRGFQMQPQHQHQHQHQHHPPGPGQPSPPPEALPCRDGTDPSQ    281 - 350
PAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYCNYPDV          351 - 414
//

Text Mined References (58)

PMID Year Title
26463399 2016 Immunohistochemical Analysis of Sox17 Associated Pathway in Brain Arteriovenous Malformations.
26411902 2015 OCT4 Coordinates with WNT Signaling to Pre-pattern Chromatin at the SOX17 Locus during Human ES Cell Differentiation into Definitive Endoderm.
25971583 2015 Decreased expression of SOX17 is associated with tumor progression and poor prognosis in breast cancer.
25953442 Screening the molecular targets of ovarian cancer based on bioinformatics analysis.
25868860 2015 The SOX17/miR-371-5p/SOX2 axis inhibits EMT, stem cell properties and metastasis in colorectal cancer.
25789956 2015 Sox17 promoter methylation in plasma DNA is associated with poor survival and can be used as a prognostic factor in breast cancer.
25674225 2014 Clinical significance of chromosome 1p/19q loss of heterozygosity and Sox17 expression in oligodendrogliomas.
25596186 2015 Deficiency of endothelium-specific transcription factor Sox17 induces intracranial aneurysm.
25543152 2015 SOX17 is a critical specifier of human primordial germ cell fate.
25310020 2014 Reduced expression of SRY-box containing gene 17 correlates with an unfavorable melanoma patient survival.
25291942 2014 Abnormal methylation of the sex-determining region Y-box 17 (SOX17) promoter predicts poor prognosis in myelodysplastic syndrome.
25106407 2014 Sox17 inhibits hepatocellular carcinoma progression by downregulation of KIF14 expression.
25053769 2015 Evaluation of genetic risk loci for intracranial aneurysms in sporadic arteriovenous malformations of the brain.
24407731 2014 Low SOX17 expression is a prognostic factor and drives transcriptional dysregulation and esophageal cancer progression.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23999170 2014 Identification and manipulation of biliary metaplasia in pancreatic tumors.
23918253 2013 SOX17 is expressed in regenerating oligodendrocytes in experimental models of demyelination and in multiple sclerosis.
23813959 2013 Matched miRNA and mRNA signatures from an hESC-based in vitro model of pancreatic differentiation reveal novel regulatory interactions.
23474492 2013 Modulation of the Wnt/beta-catenin pathway in human oligodendroglioma cells by Sox17 regulates proliferation and differentiation.
23403728 2013 Assessment of SOX17 DNA methylation in cell free DNA from patients with operable gastric cancer. Association with prognostic variables and survival.
23241958 2013 Sox17 promotes tumor angiogenesis and destabilizes tumor vessels in mice.
23169777 2013 Role of SOX17 in hematopoietic development from human embryonic stem cells.
23136251 2013 SOX17 promoter methylation in circulating tumor cells and matched cell-free DNA isolated from plasma of patients with breast cancer.
23061670 2013 Structural basis of human transcription factor Sry-related box 17 binding to DNA.
23044318 2012 Epigenetic regulation of Wnt signaling pathway gene SRY-related HMG-box 17 in papillary thyroid carcinoma.
22961961 2012 Genome-wide association study of intracranial aneurysms confirms role of Anril and SOX17 in disease risk.
22921431 2012 Inhibition of SOX17 by microRNA 141 and methylation activates the WNT signaling pathway in esophageal cancer.
22846201 2012 SOX17 methylation inhibits its antagonism of Wnt signaling pathway in lung cancer.
22348788 2012 Relevance of SOX17 variants for hypomyelinating leukodystrophies and congenital anomalies of the kidney and urinary tract (CAKUT).
22292085 2012 The transcription factor SOX18 regulates the expression of matrix metalloproteinase 7 and guidance molecules in human endothelial cells.
22161215 2012 Hypermethylation of Sox17 gene is useful as a molecular diagnostic application in early gastric cancer.
21957254 2011 SRY-box containing gene 17 regulates the Wnt/?-catenin signaling pathway in oligodendrocyte progenitor cells.
21760905 2011 Efficient and directive generation of two distinct endoderm lineages from human ESCs and iPSCs by differentiation stage-specific SOX17 transduction.
21514720 2011 Sox17 regulates proliferation and cell cycle during gastric cancer progression.
21457403 2011 CD133 is a marker of gland-forming cells in gastric tumors and Sox17 is involved in its regulation.
21362573 2011 Targeting SOX17 in human embryonic stem cells creates unique strategies for isolating and analyzing developing endoderm.
21305474 2011 Sox17-dependent gene expression and early heart and gut development in Sox17-deficient mouse embryos.
20960469 2010 Mutations in SOX17 are associated with congenital anomalies of the kidney and the urinary tract.
20716954 SOX17 antagonizes WNT/?-catenin signaling pathway in hepatocellular carcinoma.
20364137 2010 Genome-wide association study of intracranial aneurysm identifies three new risk loci.
19736317 2009 Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate.
19549530 2009 Induction and down-regulation of Sox17 and its possible roles during the course of gastrointestinal tumorigenesis.
19369635 2009 Differential expression of SOX2 and SOX17 in testicular germ cell tumors.
19301122 2010 Sox17, the canonical Wnt antagonist, is epigenetically inactivated by promoter methylation in human breast cancer.
18997786 2008 Susceptibility loci for intracranial aneurysm in European and Japanese populations.
18940723 2008 Expandable endodermal progenitors: new tools to explore endoderm and its derivatives.
18682240 2008 Establishment of endoderm progenitors by SOX transcription factor expression in human embryonic stem cells.
18564921 2008 Candidate gene analysis in primary lymphedema.
18523156 2008 SOX17 directly activates Zfp202 transcription during in vitro endoderm differentiation.
18413743 2008 Epigenetic inactivation of the canonical Wnt antagonist SRY-box containing gene 17 in colorectal cancer.
17875931 2007 Sox17 and Sox4 differentially regulate beta-catenin/T-cell factor activity and proliferation of colon carcinoma cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15163629 2004 Sox17 and beta-catenin cooperate to regulate the transcription of endodermal genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194848 2002 Twenty pairs of sox: extent, homology, and nomenclature of the mouse and human sox transcription factor gene families.
12100890 2002 Matching SOX: partner proteins and co-factors of the SOX family of transcriptional regulators.
11786926 2002 Molecular cloning and characterization of human SOX17.