Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.31
PubTator Score 12.14

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKRPMNAFMVWSSAQRRQMAQQ      1 - 70
NPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKSSGAGPSRCGQGRGN     71 - 140
LASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHY    141 - 210
LPPGSPTPYNPPLAGAPMPLTHL                                                   211 - 233
//