Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.22
PubTator Score 25.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
diabetes mellitus 1683 3.259 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.100 2.3e-02
Astrocytoma, Pilocytic 1.200 1.3e-05
glioblastoma 1.200 1.1e-04
group 4 medulloblastoma -1.100 7.1e-04
medulloblastoma, large-cell -1.200 2.4e-05
oligodendroglioma 1.100 3.4e-11
osteosarcoma 1.575 1.3e-03
Pick disease 1.100 3.5e-04
psoriasis -1.100 1.3e-08

Gene RIF (2)

AA Sequence

MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFR      1 - 70
GSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKG     71 - 140
TQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQH    141 - 210
KINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAM    211 - 280
ATHHPLQEPSQPLNLTAKPKAPELPNTSSSPSLKMSSCVPRPPSHGGPTRDLQSSPPSLPLGFLGEGDAV    281 - 350
TKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRN    351 - 420
SSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPD    421 - 490
YKYKPRPKRTCIVEGKRLRVGEYKALMRTRRQDARQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVE    491 - 560
HYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLTD            561 - 622
//

Text Mined References (28)

PMID Year Title