Property Summary

NCBI Gene PubMed Count 77
PubMed Score 106.10
PubTator Score 102.18

Knowledge Summary

Patent

No data available

Expression

 GO Component (2)

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQ      1 - 70
SPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEK     71 - 140
SAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGG    141 - 210
GGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPT    211 - 280
LSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSS    281 - 350
SGSSGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPE    351 - 420
LSEMIAGDWLEANFSDLVFTY                                                     421 - 441
//