Property Summary

NCBI Gene PubMed Count 31
PubMed Score 100.00
PubTator Score 58.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma -2.500 1.4e-06
atypical teratoid/rhabdoid tumor 2.200 4.5e-04
medulloblastoma, large-cell -2.800 3.0e-05
adult high grade glioma -1.500 7.3e-03

Gene RIF (23)

PMID Text
26782455 The results of the SRY gene amplification of plasma DNA from pregnant women was the same as that of the amniocyte DNA
26365194 The analysis identified a signaling axis between FGF signaling and the transcription factor Sox1, which is preferentially expressed in stem- and mesenchymal-like breast cancers.
26191244 downregulation of SOX-1 was correlated with poor prognosis and tumor development in hepatocellular carcinoma.
26040764 SOX 1 suppressed cell growth and invasion in Tu212 cells by inhibiting Wnt pathway, and the anti-tumor effect of SOX 1 could be weakened by SOX 2, which may be a potential molecular basis for clinical treatment of laryngeal squamous cell carcinoma .
25613070 Our results suggest that SOX1 is epigenetically silenced in the majority of NSCLC and restoration of SOX1 inhibited cell migration by regulating actin cytoskeletal remodeling in NSCLC.
25427424 SOX1 decreases the expression of beta-catenin in a proteasome-independent manner.
24799352 PAX1 and SOX1 DNA methylation correlate with a cervical intraepithelial neoplasia diagnosis.
24407576 The methylation index of SOX1 recovered from scrapings of uterine cervix adenocarcinomas is significantly higher than in normal controls.
24138016 we successfully established a three-step inducing protocol to derive Neural stem cells from adipose-derived mesenchymal stem cells with high purity by Sox1 activation
23994634 Inactivation of SOX1 gene is associated with cisplatin resistance in human non-small cell lung cancer cell.
23927962 Taken together, these data suggest that SOX1 can function as a tumor suppressor partly by interfering with Wnt/beta-catenin signaling in cervical cancer.
23278580 SOX1 antibodies are a specific marker for SCLC-LEMS but they are also found in SCLC patients without paraneoplastic neurological syndromes
23215838 Concomitant epigenetic silencing of SOX1 and SFRPs through promoter hypermethylation is frequent in hepatocellular carcinoma, and this might contribute to abnormal activation of canonical Wnt signal pathway.
22860217 The level and timing of SOX1 expression affects neural induction as well as neural lineage.
22767186 These findings suggest that SOX1 might function as an important tumor suppressor during the development of hepatocellular carcinoma.
20844123 Transgenic interneuron diversification in the p2 domain is more complex than previously thought and directly implicates Sox1 in this process.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20515335 Supratentorial PNETs expressed significantly higher levels of SOX2, NOTCH1, ID1, and ASCL-1 transcripts.
19667272 Data show that SOX antibodies have diagnostic value in discriminating SCLC-LEMS from nontumor LEMS, but have no relation to survival in patients with SCLC.
19061938 expression of Sox1, Sox2 and Sox9 was detected at the mRNA level in both foetal and adult cerebellum samples; Sox1, Sox2 and Sox9 expression was detected in the Purkinje cell layer of the adult cerebellum
18032743 The detection of SOX1 antibodies in patients with Lambert-Eaton myasthenic syndrome (LEMS) predicts the presence of small cell lung cancer and may be used to follow more closely those LEMS patients with no evidence of cancer at the initial workup.
15110721 Sox1 works through multiple independent pathways to promote neuronal cell fate determination and differentiation.
9512512 A similar protein directly regulates the gamma-crystallin genes and is essential for lens development in mice.

AA Sequence

MYSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRVKRPMNAFMVWSRGQRRKMA      1 - 70
QENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLLKKDKYSLAGG     71 - 140
LLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGGYAHVNGWANGAYPGSVAAAAAAAAMMQEAQ    141 - 210
LAYGQHPGAGGAHPHAHPAHPHPHHPHAHPHNPQPMHRYDMGALQYSPISNSQGYMSASPSGYGGLPYGA    211 - 280
AAAAAAAAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPA    281 - 350
GEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI                                 351 - 391
//

Text Mined References (32)

PMID Year Title
26782455 2015 Isolation and analysis of cell-free fetal DNA from maternal peripheral blood in Chinese women.
26365194 2015 Sox10 Regulates Stem/Progenitor and Mesenchymal Cell States in Mammary Epithelial Cells.
26191244 2015 Prognostic significance of SOX-1 expression in human hepatocelluar cancer.
26040764 2015 SOX 1, contrary to SOX 2, suppresses proliferation, migration, and invasion in human laryngeal squamous cell carcinoma by inhibiting the Wnt/?-catenin pathway.
25613070 2015 Epigenetic inactivation of SOX1 promotes cell migration in lung cancer.
25427424 2014 SOX1 down-regulates ?-catenin and reverses malignant phenotype in nasopharyngeal carcinoma.
25234806 2015 Dissecting the genetics of chronic mucus hypersecretion in smokers with and without COPD.
24799352 2014 PAX1/SOX1 DNA methylation and cervical neoplasia detection: a Taiwanese Gynecologic Oncology Group (TGOG) study.
24407576 2014 High methylation rate of LMX1A, NKX6-1, PAX1, PTPRR, SOX1, and ZNF582 genes in cervical adenocarcinoma.
24138016 2014 Generation of highly purified neural stem cells from human adipose-derived mesenchymal stem cells by Sox1 activation.
23994634 2013 Cisplatin-induced downregulation of SOX1 increases drug resistance by activating autophagy in non-small cell lung cancer cell.
23927962 2013 SOX1 suppresses cell growth and invasion in cervical cancer.
23278580 2012 SOX1 antibodies in Lambert-Eaton myasthenic syndrome and screening for small cell lung carcinoma.
23215838 2013 Frequent concomitant epigenetic silencing of SOX1 and secreted frizzled-related proteins (SFRPs) in human hepatocellular carcinoma.
22860217 2012 DMH1, a highly selective small molecule BMP inhibitor promotes neurogenesis of hiPSCs: comparison of PAX6 and SOX1 expression during neural induction.
22767186 2012 SOX1 functions as a tumor suppressor by antagonizing the WNT/?-catenin signaling pathway in hepatocellular carcinoma.
20929579 2010 Epigenetic regulation of CpG promoter methylation in invasive prostate cancer cells.
20844123 2010 Sox1 is required for the specification of a novel p2-derived interneuron subtype in the mouse ventral spinal cord.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20515335 2010 Upregulation of SOX2, NOTCH1, and ID1 in supratentorial primitive neuroectodermal tumors: a distinct differentiation pattern from that of medulloblastomas.
20049565 2010 CD56 expression in human myeloma cells derived from the neurogenic gene expression: possible role of the SRY-HMG box gene, SOX4.
19667272 2009 SOX antibodies in small-cell lung cancer and Lambert-Eaton myasthenic syndrome: frequency and relation with survival.
19061938 2009 Expression of Sox1, Sox2 and Sox9 is maintained in adult human cerebellar cortex.
18032743 2008 SOX1 antibodies are markers of paraneoplastic Lambert-Eaton myasthenic syndrome.
15110721 2004 Sox1 acts through multiple independent pathways to promote neurogenesis.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12194848 2002 Twenty pairs of sox: extent, homology, and nomenclature of the mouse and human sox transcription factor gene families.
12100890 2002 Matching SOX: partner proteins and co-factors of the SOX family of transcriptional regulators.
11071752 2000 Phylogeny of the SOX family of developmental transcription factors based on sequence and structural indicators.
10729834 2000 Pairing SOX off: with partners in the regulation of embryonic development.
9512512 1998 Sox1 directly regulates the gamma-crystallin genes and is essential for lens development in mice.
9337405 1997 Cloning and mapping of the human SOX1: a highly conserved gene expressed in the developing brain.