Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.71
PubTator Score 1.16

Knowledge Summary


No data available


  Differential Expression (22)

Disease log2 FC p
astrocytoma 1.100 6.7e-14
Astrocytoma, Pilocytic 1.300 1.7e-04
atypical teratoid / rhabdoid tumor 1.400 2.2e-04
chronic rhinosinusitis -1.058 6.5e-03
cystic fibrosis 1.100 1.4e-03
ependymoma 1.600 7.1e-07
glioblastoma 1.200 1.7e-05
group 3 medulloblastoma 1.200 2.6e-02
interstitial cystitis -1.500 8.2e-04
intraductal papillary-mucinous neoplasm ... 1.600 1.1e-03
invasive ductal carcinoma -1.199 1.7e-02
medulloblastoma, large-cell 1.200 1.4e-02
osteosarcoma 2.630 1.3e-05
ovarian cancer -1.100 3.1e-03
pancreatic ductal adenocarcinoma liver m... -1.559 3.0e-03
pediatric high grade glioma 1.300 1.8e-04
primitive neuroectodermal tumor 2.100 9.7e-04
psoriasis 1.100 5.8e-06
pulmonary arterial hypertension -2.100 4.3e-02
spina bifida -1.535 3.7e-02
Subcutaneous panniculitis-like T-cell ly... -1.200 2.7e-02
tuberculosis -1.500 2.9e-04

 Compartment GO Term (1)

AA Sequence

PEQPLEGRGEEGVGEERPVKGHSPFTLRPKSNVFG                                       491 - 525

Text Mined References (11)

PMID Year Title