Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.71
PubTator Score 1.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
psoriasis 1.600 5.2e-03
astrocytoma 1.100 6.7e-14
glioblastoma 1.500 3.1e-04
osteosarcoma 2.630 1.3e-05
ependymoma 1.800 4.9e-08
sonic hedgehog group medulloblastoma 2.900 1.2e-06
atypical teratoid / rhabdoid tumor 1.400 2.2e-04
medulloblastoma, large-cell 1.200 1.4e-02
primitive neuroectodermal tumor 2.100 9.7e-04
pancreatic ductal adenocarcinoma liver m... -1.559 3.0e-03
tuberculosis -1.600 6.5e-05
intraductal papillary-mucinous neoplasm ... 1.700 1.1e-02
interstitial cystitis -2.000 1.4e-05
cystic fibrosis 1.100 1.4e-03
pediatric high grade glioma 1.300 1.8e-04
pilocytic astrocytoma 1.400 2.6e-05
invasive ductal carcinoma -1.199 1.7e-02
pulmonary arterial hypertension -3.100 3.6e-02
spina bifida -1.535 3.7e-02
Subcutaneous panniculitis-like T-cell ly... -1.200 2.7e-02
ovarian cancer -1.300 5.6e-04
chronic rhinosinusitis -1.058 6.5e-03

AA Sequence

MEGPAEWGPEAALGPEAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDP      1 - 70
ADGAKYVHLKKRFCEGPSEPSGDPPRIQVTAEPEAPDGPAGPEARDRLPDAAAPESLPGQGRELGEGEPP     71 - 140
APAHWPPLSAGARRKNSRRDVQPLPRTPAPGPSEDLELPPHGCEEADRGSSLVGATAQRPARQNLRDLVM    141 - 210
GSSPQLKRSVCPGGSSPGSSSGGGRGRGGGDSDSASVASSSAEEESSGGGSVTLDPLEHAWMLSASDGKW    211 - 280
DSLEGLLTCEPGLLVKRDFITGFTCLHWAAKHGRQELLAMLVNFANKHQLPVNIDARTSGGYTALHLAAM    281 - 350
HGHVEVVKLLVGAYDADVDIRDYSGKKASQYLSRSIAEEIKNLVGALDEGDGESAAGSGGGRWRLSKVLP    351 - 420
SHLITYKLSHALEDGGDHHHHHHSAEGWVGGKAKDPGRKASGSSSGRIKPRLNKIRFRTQIVHTTPSFRD    421 - 490
PEQPLEGRGEEGVGEERPVKGHSPFTLRPKSNVFG                                       491 - 525
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22234889 2012 An ancient genomic regulatory block conserved across bilaterians and its dismantling in tetrapods by retrogene replacement.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.