Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.25
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -3.000 6.2e-04
astrocytic glioma -3.300 3.8e-03
Astrocytoma, Pilocytic -2.200 3.3e-04
atypical teratoid / rhabdoid tumor -5.300 3.0e-12
cystic fibrosis -1.400 9.6e-04
ependymoma -4.200 6.5e-04
glioblastoma -3.100 3.8e-08
group 3 medulloblastoma -3.600 1.4e-03
interstitial cystitis -2.700 9.8e-05
intraductal papillary-mucinous carcinoma... 1.100 4.5e-02
medulloblastoma, large-cell -5.200 3.0e-07
oligodendroglioma -3.100 3.5e-03
ovarian cancer 1.400 4.4e-06
primitive neuroectodermal tumor -4.000 7.1e-05
psoriasis -1.400 2.6e-30
subependymal giant cell astrocytoma -3.657 3.7e-03
ulcerative colitis -2.500 6.7e-06
urothelial carcinoma -2.200 7.3e-04

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MALAAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKE      1 - 70
LDGVKFVVLRKKPRPPEPEPAPFGPPGAAAQPSKPTSTVLPRSASAPGAPPLVRVPRPVEPPGDLGLPTE     71 - 140
PQDTPGGPASEPAQPPGERSADPPLPALELAQATERPSADAAPPPRAPSEAASPCSDPPDAEPGPGAAKG    141 - 210
PPQQKPCMLPVRCVPAPATLRLRAEEPGLRRQLSEEPSPRSSPLLLRRLSVEESGLGLGLGPGRSPHLRR    211 - 280
LSRAGPRLLSPDAEELPAAPPPSAVPLEPSEHEWLVRTAGGRWTHQLHGLLLRDRGLAAKRDFMSGFTAL    281 - 350
HWAAKSGDGEMALQLVEVARRSGAPVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDHSGR    351 - 420
RAYQYLRPGSSYALRRLLGDPGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAFLGVLADDLMLQ    421 - 490
DLARGLKKSSSFSKFLSASPMAPRKKTKIRGGLPAFSEISRRPTPGPLAGLVPSFPPTT               491 - 549
//

Text Mined References (6)

PMID Year Title