Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -2.200 7.3e-04
astrocytic glioma -3.300 3.8e-03
ependymoma -4.200 6.5e-04
oligodendroglioma -3.100 3.5e-03
glioblastoma -4.900 3.1e-11
medulloblastoma -5.400 7.0e-10
atypical teratoid / rhabdoid tumor -5.300 3.0e-12
medulloblastoma, large-cell -5.200 3.0e-07
primitive neuroectodermal tumor -4.000 7.1e-05
intraductal papillary-mucinous carcinoma... 1.100 4.5e-02
interstitial cystitis -2.700 9.8e-05
cystic fibrosis -1.400 9.6e-04
pediatric high grade glioma -3.800 3.5e-08
pilocytic astrocytoma -2.300 2.5e-04
subependymal giant cell astrocytoma -3.657 3.7e-03
ulcerative colitis -2.500 6.7e-06
ovarian cancer 1.400 4.4e-06
psoriasis -1.400 2.6e-30

Gene RIF (1)

PMID Text
18187620 Knockdown of sosondowah ankyrin repeat domain family member A (SOWAHA; ANKRD43) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MALAAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKE      1 - 70
LDGVKFVVLRKKPRPPEPEPAPFGPPGAAAQPSKPTSTVLPRSASAPGAPPLVRVPRPVEPPGDLGLPTE     71 - 140
PQDTPGGPASEPAQPPGERSADPPLPALELAQATERPSADAAPPPRAPSEAASPCSDPPDAEPGPGAAKG    141 - 210
PPQQKPCMLPVRCVPAPATLRLRAEEPGLRRQLSEEPSPRSSPLLLRRLSVEESGLGLGLGPGRSPHLRR    211 - 280
LSRAGPRLLSPDAEELPAAPPPSAVPLEPSEHEWLVRTAGGRWTHQLHGLLLRDRGLAAKRDFMSGFTAL    281 - 350
HWAAKSGDGEMALQLVEVARRSGAPVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDHSGR    351 - 420
RAYQYLRPGSSYALRRLLGDPGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAFLGVLADDLMLQ    421 - 490
DLARGLKKSSSFSKFLSASPMAPRKKTKIRGGLPAFSEISRRPTPGPLAGLVPSFPPTT               491 - 549
//

Text Mined References (6)

PMID Year Title
22234889 2012 An ancient genomic regulatory block conserved across bilaterians and its dismantling in tetrapods by retrogene replacement.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.