Property Summary

NCBI Gene PubMed Count 33
PubMed Score 32.50
PubTator Score 21.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.100 2.1e-02
Multiple myeloma 1.034 1.1e-02
cutaneous lupus erythematosus -1.100 1.7e-02
psoriasis -3.800 6.2e-05
osteosarcoma -2.530 1.1e-05
ependymoma 1.100 2.2e-04
group 4 medulloblastoma 2.000 1.5e-04
atypical teratoid / rhabdoid tumor 1.200 9.3e-06
glioblastoma 1.100 2.3e-02
hereditary spastic paraplegia -1.081 9.4e-03
ulcerative colitis -1.100 2.2e-03
ovarian cancer -1.600 1.8e-06
Gaucher disease type 1 -1.400 1.6e-02
dermatomyositis -1.600 5.2e-04

 MGI Phenotype (1)

Gene RIF (8)

PMID Text
26173643 Activating Mutations Affecting the Dbl Homology Domain of SOS2 Cause Noonan Syndrome
25795793 We identified two novel genes, SOS2 and LZTR1, associated with Noonan syndrome, thereby expanding the molecular spectrum of RASopathies.
23761422 multicenter pharmacogenetic study in children (ages 6-11): Data suggest that SNP in SOS2 (rs13379306) in children with growth hormone deficiency is associated with drug resistance to hormone replacement therapy with recombinant human growth hormone.
20618341 intracellular Francisella tularensis novicida triggers temporal and early activation of Ras through the SOS2/GrB2/PKCalpha/PKCbetaI quaternary complex; Ras signalling by intracellular F. tularensis is essential for intracellular proliferation in the cytosol
19911011 Observational study of gene-disease association. (HuGE Navigator)
19289468 Loss of MADD expression resulted in reduced Grb2 and Sos1/2 recruitment to the TNFR1 complex and decreased Ras and MEKK1/2 activation
17440948 Observational study of gene-disease association. (HuGE Navigator)
17440948 Significant association of single nucleotide polymorphism within three genes--PPARgamma, SOS2, and PCK1--with Alzheimer's disease, was confirmed.

AA Sequence

MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLCMAQPRTVQDV      1 - 70
EERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSLYIVAVLEYISAD     71 - 140
ILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDDIGLVSLCEDEPSSSGELNYYDLVRTEIAEE    141 - 210
RQYLRELNMIIKVFREAFLSDRKLFKPSDIEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSC    211 - 280
FEDLAEEQAFDPYETLSQDILSPEFHEHFNKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWH    281 - 350
YFELLKQLKACSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYSHQLRSKHLAIKKM    351 - 420
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPGYSSAEYRLKE    421 - 490
KFVMRKIQICDKEDTCEHKHAFELVSKDENSIIFAAKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEE    491 - 560
NEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYR    561 - 630
SFCKPQELLSLLIERFEIPEPEPTDADKLAIEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFY    631 - 700
DFERDLELLERLESFISSVRGKAMKKWVESIAKIIRRKKQAQANGVSHNITFESPPPPIEWHISKPGQFE    701 - 770
TFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA    771 - 840
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILDEAVELSQDHF    841 - 910
KKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLR    911 - 980
IEPDMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNTGRHGSTSG    981 - 1050
TLRGHPTPLEREPCKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAP   1051 - 1120
VLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVP   1121 - 1190
VPTGAFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDSDWLRDISTCPNSPS   1191 - 1260
TPPSTPSPRVPRRCYVLSSSQNNLAHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLYRLPLLENAET   1261 - 1330
PQ                                                                       1331 - 1332
//

Text Mined References (35)

PMID Year Title
26173643 2015 Activating Mutations Affecting the Dbl Homology Domain of SOS2 Cause Noonan Syndrome.
25795793 2015 Rare variants in SOS2 and LZTR1 are associated with Noonan syndrome.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
23761422 2013 A pharmacogenomic approach to the treatment of children with GH deficiency or Turner syndrome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
20936779 2010 A human MAP kinase interactome.
20618341 2010 Triggering Ras signalling by intracellular Francisella tularensis through recruitment of PKC? and ?I to the SOS2/GrB2 complex is essential for bacterial proliferation in the cytosol.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19289468 2009 MADD, a splice variant of IG20, is indispensable for MAPK activation and protection against apoptosis upon tumor necrosis factor-alpha treatment.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17440948 2007 Candidate gene association study of insulin signaling genes and Alzheimer's disease: evidence for SOS2, PCK1, and PPARgamma as susceptibility loci.
17143285 2007 Germline gain-of-function mutations in SOS1 cause Noonan syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14679214 2004 A novel proteomic screen for peptide-protein interactions.
14551139 2004 Identification and characterization of EBP, a novel EEN binding protein that inhibits Ras signaling and is recruited into the nucleus by the MLL-EEN fusion protein.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12628188 2003 Structural evidence for feedback activation by Ras.GTP of the Ras-specific nucleotide exchange factor SOS.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12097864 2002 Fibroblast growth factor receptor (FGFR) and candidate signaling molecule distribution within rat and human retina.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11003655 2000 Abl interactor 1 binds to sos and inhibits epidermal growth factor- and v-Abl-induced activation of extracellular signal-regulated kinases.
10940929 2000 Engagement of the T lymphocyte antigen receptor regulates association of son-of-sevenless homologues with the SH3 domain of phospholipase Cgamma1.
10938118 2000 Ras-guanine nucleotide exchange factor sos2 is dispensable for mouse growth and development.
10820259 2000 GRID: a novel Grb-2-related adapter protein that interacts with the activated T cell costimulatory receptor CD28.
10675333 2000 The Sos1 and Sos2 Ras-specific exchange factors: differences in placental expression and signaling properties.
9372945 1997 The Ras-specific exchange factors mouse Sos1 (mSos1) and mSos2 are regulated differently: mSos2 contains ubiquitination signals absent in mSos1.
9067577 1997 The BCR/ABL oncogene alters interaction of the adapter proteins CRKL and CRK with cellular proteins.
8943292 1996 B cell antigen receptor signaling induces the formation of complexes containing the Crk adapter proteins.
8493579 1993 Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.
8276400 1993 Mammalian homologues of the Drosophila Son of sevenless gene map to murine chromosomes 17 and 12 and to human chromosomes 2 and 14, respectively.
7629138 1995 Differential interactions of human Sos1 and Sos2 with Grb2.