Property Summary

NCBI Gene PubMed Count 127
PubMed Score 197.02
PubTator Score 183.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.138 4.5e-02
chronic lymphosyte leukemia -3.400 1.3e-12
malignant mesothelioma 4.600 2.6e-09
astrocytoma 2.100 2.2e-03
oligodendroglioma 1.500 8.6e-03
psoriasis -1.600 1.2e-08
osteosarcoma -2.740 1.0e-02
glioblastoma -1.400 6.0e-03
group 3 medulloblastoma -3.800 9.1e-08
atypical teratoid / rhabdoid tumor -2.900 6.8e-06
medulloblastoma, large-cell -4.000 2.7e-09
primitive neuroectodermal tumor -1.500 2.3e-04
primary pancreatic ductal adenocarcinoma 1.166 1.1e-02
intraductal papillary-mucinous adenoma (... 2.000 3.5e-04
intraductal papillary-mucinous carcinoma... 1.300 5.0e-03
lung cancer -1.400 1.8e-03
interstitial cystitis -2.200 5.6e-06
posterior fossa group A ependymoma -1.100 2.1e-06
invasive ductal carcinoma 1.655 2.0e-02
lung carcinoma 1.100 3.7e-14
Breast cancer -1.300 5.0e-05
ovarian cancer 2.600 5.9e-05
pancreatic cancer 1.200 2.3e-02
dermatomyositis 1.200 1.5e-02

Protein-protein Interaction (1)

Gene RIF (125)

PMID Text
26858303 CLF-1, based on its binding site for CLC and on two additional and independent sites for CNTFRalpha and sorLA, is a key player in CLC and CNTFRalpha signaling and turnover.
26584636 sLR11 levels in humans are shown to positively correlate with body mass index and adiposity.
26520897 Elevated sLR11 levels may increase the cardiovascular disease risk especially in subjects with delayed clearance of triglyceride-rich remnants, such as in familial hypercholesterolemia patients.
26377460 Mutating recombinant human SORLA, disrupting retromer binding caused retrograde-sorting defect, endosomal accumulation, TGN, depletion, and enhanced APP processing. Disrupting the GGA interaction increased Abeta via defective anterograde lysosomal targeting.
25881907 The findings of this study confirm that SORL1 is associated with Alzheimer's Disease and might be a potential tool for identifying Mild Cognitive Impairment subjects at high risk of conversion to lzheimer's Disease.
25835329 Mutants of metal binding site M1 in APP E2 show metal specific differences in binding of heparin but not of sorLA
25772071 genetic polymorphism controls protein expression, which directly regulates the amount of Abeta peptides implicated in Alzheimer's disease
25676033 Serum soluble LR11, a novel tumor derived biomarker associated with the outcome of patients with diffuse large B-cell lymphoma
25659857 SORL1 may be implicated in the downstream pathology in AD.
25598427 Study suggested a sex-moderated association of the SORL1 rs2070045 polymorphism and executive function in healthy elderly
25525276 SORLA CR(5-8) cluster binds APP and is essential for the SorLA-dependent decrease in APP proteolysis.
25482438 human-apoE-isoform-dependent differences modulate the cellular uptake of Abeta mediated by LR11/SorLA
25450149 SORL1 gene SNPs at rs689021 and rs3824966 loci show no relationship with LOAD onset in the Chinese Han population of the Hunan Changsha region. A SORL1 gene SNP at the rs1784933 locus is associated with LOAD onset, with the A allele being a risk factor.
25443876 circulating sLR11 levels may be a potential marker for angiographic late loss in patients after coronary stenting
25382023 Seventeen coding exonic variants were significantly associated with Alzheimer's disease.
25365775 Brain DNA methylation in SORL1 was associated with pathological Alzheimer disease.
24938503 Study shows that SORL1 SNPs and haplotypes are associated with Alzheimer's disease, and their neuroimaging endophenotypes of whole brain and hippocampal atrophy; suggests that SORL1 may contribute differentially to changes in men and women
24859021 SLR11 had a positive correlation with average ATT.
24650663 Serotonin enhanced expression of LR11 mRNA in vascular smooth muscle cells.
24577511 The soluble form of LR11 is a novel candidate modifier of G-CSF-mediated mobilization of hematologic cells.
24486888 the SORL1 SNP rs985421 may alter the risk for sporadic Alzheimer disease and amnestic mild cognitive impairment in the Han Chinese population.
24394293 sLR11 may be a novel soluble receptor indicative of early-stage non-Hodgkin's lymphoma, with potential use for evaluating therapeutic efficacy
24309291 An association between SORL1 rs2070045 polymorphism and late-onset Alzheimer's disease is identified in a Chinese Han population.
24284991 Coronary endothelial LR11 expression modulated by LDL and chronic shear stress contributes to atherogenesis.
24166411 SORL1 risk variants influenced microstructure of white matter tracts with known susceptibility in Alzheimer's disease with consistent effect from childhood onward and predicted lower levels of mRNA expression
24083537 results indicated that the SNPs in the 3' region of SORL1 are associated with aMCI in northern Han Chinese.
24001769 PACS1 plays an important role in protein sorting for amyloidogenic-burden control via both SORLA-dependent and SORLA-independent mechanisms.
23977241 SORLA-mediated trafficking of TrkB enhances the response of neurons to BDNF.
23948893 The current meta-analysis further supports the previous findings that the SORL1 gene may be associated with sporadic Alzheimer's disease risk.
23813966 SORLA emerges as a central regulator of trafficking and processing of the amyloid precursor protein in Alzheimer's Disease. (Review)
23652469 Vitreous fluid sLR11 level may be a novel risk factor for the early development of PDR prior to the increase in circulating levels in diabetic patients.
23565137 SORL1 is genetically associated with late-onset Alzheimer's disease in Japanese, Koreans and Caucasians.
23525328 SORL1 has an independent role in Alzheimer disease, irrespective of the presence of the APOE*4 allele.
23486467 sLR11 regulates the hypoxia-enhanced adhesion of HSPCs via an uPAR-mediated pathway that stabilizes the hematological pool size by controlling cell attachment to the BM niche.
23463934 The results of this study suggested that SORL1 does not appear to be a major risk factor for late onset Alzheimer's disease.
23455993 Our replication study strongly supports the preceding evidence that SORL1 is likely one of the genes associated late-onset Alzheimer's disease
23127357 There is a statistically significant association between circulating LR11 and acute coronary syndrome.
22996644 The finding of a non-coding (nc) RNA (hereafter referred to as 51A) that maps in antisense configuration to intron 1 of the SORL1 gene, is reported.
22927900 the relationship between LR11 expression and the development of Alzheimer's disease
22836009 found that SORL1 promoter DNA methylation might act as one of the mechanisms responsible for the differences in expression observed between blood and brain for both healthy elderly and AD patients groups
22750733 LR11 and its released soluble form are strongly elevated in acute leukemias.
22621900 On basis of these results, propose that GGA1 facilitates LR11 endocytic traffic and that LR11 modulates A-beta levels by promoting amyloid-beta precursor protein traffic to the endocytic recycling compartment
22472873 results suggest that besides the involvement of the APP and PSEN genes, further genetic heterogeneity, involving another gene of the same pathway (SORL1) is present in ADEOAD.
22297619 [rerview] The impact of SorLA on the cellular processing of amyloid precursor protein (APP) is an important component in Alzheimer's disease.
22286501 Associations between SORL1 genetic variants and CSF levels of Ab42, Tau, and SORL1 were observed at two distinct gene regions in patients with mild cognitive impairment and probable Alzheimer's disease.
22279231 A sequence (FANSHY) in the cytoplasmic domain of sorLA and the retromer complex functionally interacts in neurons to control trafficking and amyloidogenic processing of amyloid precursor protein (APP).
22127416 A direct or indirect cav-1/sorLA interaction could modify the trafficking and sorting functions of sorLA in glia and its proposed neuroprotective role in Alzheimer's disease.
22044026 The results of this study suggested that no association was detected between SORL1 genotypes and late-onset Alzheimer's disease.
21997402 SORL1 genetic variants are related to Alzheimer's disease pathology
21994944 overexpression of SorLA could enhance the regulated secretion of the GDNF prodomain-GFP fusion protein, suggesting that the prodomain of GDNF is responsible for its regulated secretion.
21989385 Minimal decline in SORLA activity contributes to amyloidogenic processing.
21730226 the SORL1 gene is associated with differences in hippocampal volume in young, healthy adults.
21385844 LPL binds to SorLA in the biosynthetic pathway and is subsequently transported to endosomes.
21220680 This meta-analysis provides confirmatory evidence that multiple SORL1 variants in distinct linkage equlibrium blocks are associated with Alzheimer's disease.
21206043 Human LR11 Vps10p domain was expressed in mammalian cells and the purified protein was crystallized using the hanging-drop vapour-diffusion method.
21185108 The temporal cortex is more susceptible to Alzheimer's pathology and demonstrates a 2-fold increase in SORL1-mRNA levels in carriers of the minor alleles at single nucleotide polymorphisms, compared with noncarriers.
21147781 LR11 is phosphorylated in vivo and indicate that ROCK2 phosphorylation of LR11 may enhance LR11 mediated processing of APP and amyloid production.
20970138 overexpression of SorLA increased migration of THP-1 monocytes to monocyte chemoattractant protein-1 with a coincident increase in UPAR expression.
20946940 A gene association of single nucleotide polymorphisms in SORL1 is found in subjects with dementia of Alzheimer's disease and Down syndrome.
20946940 Observational study of gene-disease association. (HuGE Navigator)
20880607 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20689279 These results suggest that the quantification of cerebrospinal fluid sLR11 may serve as a biomarker of Alzheimer disease, although the diagnostic value for individual patients is limited
20667857 Observational study of gene-disease association. (HuGE Navigator)
20634593 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625269 SNPs may play a role in late-onset Alzheimer disease susceptibility among Han Chinese
20625269 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20574532 Observational study of gene-disease association. (HuGE Navigator)
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20413850 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20047743 the circulating sLR11 might have a role in coronary organic stenosis
19913121 Observational study of gene-disease association. (HuGE Navigator)
19889475 Observational study of gene-disease association. (HuGE Navigator)
19889229 Observational study of gene-disease association. (HuGE Navigator)
19822782 Our results confirm the association of SORL1 with Alzheimer disease and show a possible effect of female sex
19822782 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19653016 SORL1 has a role in dementia risk in Swedes [meta-analysis]
19653016 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19584446 Analysis of single nucleotide polymorphisms in the SORL1 gene finds no association with either Alzheimer's disease or with cognitive function after adjusting for multiple testing.
19584446 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19539718 Genetic variants of SORL1 affect susceptibility to late-onset AD.
19539718 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19368828 our data support a role of SORL1 polymorphisms in Alzheimer Disease.
19368828 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19364927 In patients with Alzheimer disease as well as those with the amnesic form of mild cognitive impairment, an early stage of Alzheimer disease, the expression of SORL1 is reduced in the brain.
19077115 Observational study of gene-disease association. (HuGE Navigator)
19064752 Variants of SORL1 associated with AD are also associated with MRI and neuropathological measures of neurodegenerative and cerebrovascular disease.
19064752 Observational study of gene-disease association. (HuGE Navigator)
18938222 This study fail support a regulatory role for SORL1 polymorphisms in mRNA expression.
18830724 Meta-analysis of gene-disease association. (HuGE Navigator)
18713574 2 clusters of single nucleotide polymorphisms in the SORL1 are causally associated with late-onset Alzheimer's disease. At the cellular level, SORL1 is involved in intracellular trafficking of amyloid precursor protein. Review.
18685254 our study failed to detect any association between the single nucleotide polymorhisms and Alzheimer's disease in Japanese
18685254 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18603531 apoA-V binds to receptors possessing LDL-A repeats and Vsp10p domains, including SorLA and Sortilin, and apoA-V is internalized into cells via these receptors
18562096 Data show that the analysis of allele, genotype and haplotype frequencies reveals no association of SORL1 SNPs with late-onset Alzheimer's disease with in a large Caucasian American case-controls cohort.
18562096 Observational study of gene-disease association. (HuGE Navigator)
18541377 This study found a SORL1 haplotype which was associated with CSF levels of amyloid-beta cleavage products, measured as altered levels of Abeta42. Thus our data suggest that SORL1 gene variants might influence AD pathology.
18541377 Observational study of gene-disease association. (HuGE Navigator)
18407551 Two signals in distinct regions of SORL1 were shown to be mutually independent, supporting allelic heterogeneity at the SORL1 locus in Belgians. Findings confirm that genetic variants in SORL1 may be important risk factors for late-onset Alzheimer disease
18407551 Observational study of gene-disease association. (HuGE Navigator)
18093545 SORL l are associated with Alzheimer's disease and releated to the trafficking of Amyloid Protein Precursor in subcellular lever.
18090307 Observational study of gene-disease association. (HuGE Navigator)
18090307 These results provide an independent replication of the association between Alzheimer's disease and SORL1
18063222 Our study suggests that certain SORL1 haplotypes at SNPs 19-24 modulated risk of AD in our Chinese population.
18063222 Observational study of gene-disease association. (HuGE Navigator)
17978276 There was a significant association between genetic variants of SORL1 protein and autopsy-confirmed Alzheimer disease.
17975299 Results of our large case-control whole-genome scan at over 500,000 polymorphisms present weak evidence for association and potentially narrows the association interval.
17949987 One SNP rs2070045 was marginally replicated in the three sample sets combined (nominal P=0.035); however, this result does not remain significant when accounting for multiple comparisons.
17949987 Observational study of gene-disease association. (HuGE Navigator)
17826910 Observational study of gene-disease association. (HuGE Navigator)
17826910 These findings indicate a modest association of variants in SORL1 with AD.
17721864 Neuronal LR11 levels are reduced in prodomal Alzheimer's disease(AD). Correlation between LR11 expression and cognition indicates reduced LR11 levels reflect disease severity and may predict progression to AD in subgroup of mild cognitive impairment.
17589324 Reduction of sortilin-1 in Alzheimer hippocampus .
17420311 Observational study of gene-disease association. (HuGE Navigator)
17420311 Finding of novel SNP and haplotype associations suggests that there may be extensive allelic heterogeneity in SORL1, and broad regions of the SORL1 gene will therefore need to be scrutinized for functional pathogenic variants.
17220890 We report here that inherited variants in the SORL1 neuronal sorting receptor are associated with late-onset Alzheimer disease
16565469 he sorting protein-related receptor sorLA/LR11 regulates processing and trafficking of the precursor of the amyloid-beta peptides, revealing an alternative target for developing molecular clinical therapeutic compounds for Alzheimer Disease.
16531402 SorLA might directly regulate transcription after activation by gamma-secretase
16489755 analytical ultracentrifugation of recombinant APP and sorLA fragments further narrowed down the binding domains to the cluster of complement-type repeats in sorLA that forms a 1:1 stoichiometric complex with the carbohydrate-linked domain of APP
16407538 SorLA acts as a trafficking receptor that prevents beta-site APP-cleaving enzyme interactions with amyloid precursor protein & hence BACE cleavage of APP.
16174740 Reduced sorLA expression in the human brain may increase amyloid beta-peptide production and plaque formation and promote spontaneous Alzheimer's disease.
15313836 Low-density lipoprotein receptor expression, relative with 11 binding repeats (LR11), shows dramatic and consistent loss of immunocytochemical staining in histologically normal-appearing neurons in Alzheimer disease brains compared to controls.
14764453 Secretion of soluble LR11 is induced in SMCs during the rapidly proliferating phase, & the secreted LR11 induces the migration activities of SMCs. Both the cell-anchored & secreted forms of LR11 have the capacity to bind to and form complexes with uPAR.
12530537 sorLA is necessary for head activator signaling and function

AA Sequence

MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGAS      1 - 70
RADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYD     71 - 140
YGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLL    141 - 210
LHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRS    211 - 280
TDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYY    281 - 350
IADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGL    351 - 420
QGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLR    421 - 490
RMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNE    491 - 560
LKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDY    561 - 630
KLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCV    631 - 700
PDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIY    701 - 770
RYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFE    771 - 840
PLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGS    841 - 910
AAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQ    911 - 980
LSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNACVPRPCSLLCLPKANNSRSCRCPEDVSSSV    981 - 1050
LPSGDLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLD   1051 - 1120
TQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEA   1121 - 1190
NCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLR   1191 - 1260
DCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGF   1261 - 1330
QCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDE   1331 - 1400
KDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGR   1401 - 1470
CDRFEFECHQPKTCIPNWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDC   1471 - 1540
SDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKT   1541 - 1610
NTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTH   1611 - 1680
GLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPP   1681 - 1750
PDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISA   1751 - 1820
WAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTT   1821 - 1890
SLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPD   1891 - 1960
QDLLYAVAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDAL   1961 - 2030
KIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQAR   2031 - 2100
CLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFT   2101 - 2170
AFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA                             2171 - 2214
//

Text Mined References (134)

PMID Year Title
26858303 2016 Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor ? Signaling and sorLA-Mediated Turnover.
26584636 2015 Soluble LR11/SorLA represses thermogenesis in adipose tissue and correlates with BMI in humans.
26520897 2015 LR11/SorLA links triglyceride-rich lipoproteins to risk of developing cardiovascular disease in FH patients.
26377460 2015 Distinct Functions for Anterograde and Retrograde Sorting of SORLA in Amyloidogenic Processes in the Brain.
25881907 2015 SORL1 Gene is Associated with the Conversion from Mild Cognitive Impairment to Alzheimer's Disease.
25835329 2015 Mutants of metal binding site M1 in APP E2 show metal specific differences in binding of heparin but not of sorLA.
25772071 2015 Elucidating molecular phenotypes caused by the SORL1 Alzheimer's disease genetic risk factor using human induced pluripotent stem cells.
25676033 2015 Serum soluble LR11, a novel tumor derived biomarker associated with the outcome of patients with diffuse large B-cell lymphoma.
25659857 2015 Influence of genetic variants in SORL1 gene on the manifestation of Alzheimer's disease.
25598427 2015 Sex moderates the effects of the Sorl1 gene rs2070045 polymorphism on cognitive impairment and disruption of the cingulum integrity in healthy elderly.
25525276 2015 SorLA complement-type repeat domains protect the amyloid precursor protein against processing.
25482438 2015 ApoE-isoform-dependent cellular uptake of amyloid-? is mediated by lipoprotein receptor LR11/SorLA.
25450149 2015 SORL1 gene polymorphism association with late-onset Alzheimer's disease.
25443876 2014 Circulating soluble LR11, a novel marker of smooth muscle cell proliferation, is enhanced after coronary stenting in response to vascular injury.
25382023 2015 Coding mutations in SORL1 and Alzheimer disease.
25365775 2015 Association of Brain DNA methylation in SORL1, ABCA7, HLA-DRB5, SLC24A4, and BIN1 with pathological diagnosis of Alzheimer disease.
24938503 2014 Association of SORL1 gene variants with hippocampal and cerebral atrophy and Alzheimer's disease.
24859021 2014 Clinical significance of measuring soluble LR11, a circulating marker of atherosclerosis and HbA1c in familial hypercholesterolemia.
24668473 2014 Sortilins in neurotrophic factor signaling.
24650663 2014 Effects of serotonin on expression of the LDL receptor family member LR11 and 7-ketocholesterol-induced apoptosis in human vascular smooth muscle cells.
24577511 2014 G-CSF induces the release of the soluble form of LR11, a regulator of myeloid cell mobilization in bone marrow.
24523320 2014 Lysosomal sorting of amyloid-? by the SORLA receptor is impaired by a familial Alzheimer's disease mutation.
24486888 2014 The SORL1 polymorphism rs985421 may confer the risk for amnestic mild cognitive impairment and Alzheimer's disease in the Han Chinese population.
24394293 2014 Circulating LR11 is a novel soluble-receptor marker for early-stage clinical conditions in patients with non-Hodgkin's lymphoma.
24309291 2014 Association between the SORL1 rs2070045 polymorphism and late-onset Alzheimer's disease: interaction with the ApoE genotype in the Chinese Han population.
24284991 2014 Known players, new interplay in atherogenesis: Chronic shear stress and carbamylated-LDL induce and modulate expression of atherogenic LR11 in human coronary artery endothelium.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24166411 2014 The SORL1 gene and convergent neural risk for Alzheimer's disease across the human lifespan.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24083537 2014 SORL1 genetic variants modulate risk of amnestic mild cognitive impairment in northern Han Chinese.
24001769 2013 SORLA-dependent and -independent functions for PACS1 in control of amyloidogenic processes.
23977241 2013 SORLA-mediated trafficking of TrkB enhances the response of neurons to BDNF.
23948893 2013 An updated meta-analysis of the association between SORL1 variants and the risk for sporadic Alzheimer's disease.
23813966 2013 Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.
23652469 2013 Vitreous fluid and circulating levels of soluble lr11, a novel marker for progression of diabetic retinopathy.
23565137 2013 SORL1 is genetically associated with late-onset Alzheimer's disease in Japanese, Koreans and Caucasians.
23525328 2013 Single-nucleotide polymorphisms of GSK3B, GAB2 and SORL1 in late-onset Alzheimer's disease: interactions with the APOE genotype.
23486467 2013 The soluble form of LR11 protein is a regulator of hypoxia-induced, urokinase-type plasminogen activator receptor (uPAR)-mediated adhesion of immature hematological cells.
23463934 2013 Effects of SORL1 gene on Alzheimer's disease. Focus on gender, neuropsychiatric symptoms and pro-inflammatory cytokines.
23455993 2013 SORL1 is genetically associated with neuropathologically characterized late-onset Alzheimer's disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23127357 2013 Increased circulating soluble LR11 in patients with acute coronary syndrome.
22996644 2013 An intronic ncRNA-dependent regulation of SORL1 expression affecting A? formation is upregulated in post-mortem Alzheimer's disease brain samples.
22927900 2012 Neuronal LR11 expression does not differentiate between clinically-defined Alzheimer's disease and control brains.
22836009 2012 SORL1 and SIRT1 mRNA expression and promoter methylation levels in aging and Alzheimer's Disease.
22750733 2012 Circulating soluble LR11/SorLA levels are highly increased and ameliorated by chemotherapy in acute leukemias.
22621900 2012 GGA1-mediated endocytic traffic of LR11/SorLA alters APP intracellular distribution and amyloid-? production.
22472873 2012 High frequency of potentially pathogenic SORL1 mutations in autosomal dominant early-onset Alzheimer disease.
22297619 2012 Sortilin and SorLA regulate neuronal sorting of trophic and dementia-linked proteins.
22286501 2012 SORL1 genetic variants and cerebrospinal fluid biomarkers of Alzheimer’s disease.
22279231 2012 Retromer binds the FANSHY sorting motif in SorLA to regulate amyloid precursor protein sorting and processing.
22127416 2012 SorLA in glia: shared subcellular distribution patterns with caveolin-1.
22044026 2012 Association of SORL1 alleles with late-onset Alzheimer's disease. findings from the GIGAS_LOAD study and mega-analysis.
21997402 2011 Impact of SORL1 single nucleotide polymorphisms on Alzheimer's disease cerebrospinal fluid markers.
21994944 2011 Sorting protein-related receptor SorLA controls regulated secretion of glial cell line-derived neurotrophic factor.
21989385 2012 Quantitative modelling of amyloidogenic processing and its influence by SORLA in Alzheimer's disease.
21730226 2011 Association of the Alzheimer's gene SORL1 with hippocampal volume in young, healthy adults.
21385844 2011 SorLA regulates the activity of lipoprotein lipase by intracellular trafficking.
21220680 2011 Meta-analysis of the association between variants in SORL1 and Alzheimer disease.
21206043 2011 Crystallization and preliminary crystallographic analysis of human LR11 Vps10p domain.
21185108 2012 The Alzheimer's associated 5' region of the SORL1 gene cis regulates SORL1 transcripts expression.
21147781 2011 Rho kinase II phosphorylation of the lipoprotein receptor LR11/SORLA alters amyloid-beta production.
20970138 2010 SorLA modulates atheroprotective properties of CLA by regulating monocyte migration.
20946940 2011 Association of variants within APOE, SORL1, RUNX1, BACE1 and ALDH18A1 with dementia in Alzheimer's disease in subjects with Down syndrome.
20880607 2012 Exploration of 16 candidate genes identifies the association of IDE with Alzheimer's disease in Han Chinese.
20838585 2010 Longitudinal genome-wide association of cardiovascular disease risk factors in the Bogalusa heart study.
20689279 2010 Increased levels of soluble LR11 in cerebrospinal fluid of patients with Alzheimer disease.
20667857 2011 Genetic risk factors for cerebral small-vessel disease in hypertensive patients from a genetically isolated population.
20634593 2010 Validating predicted biological effects of Alzheimer's disease associated SNPs using CSF biomarker levels.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625269 Amyloid-?-related genes SORL1 and ACE are genetically associated with risk for late-onset Alzheimer disease in the Chinese population.
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20413850 2010 Systematic analysis of candidate genes for Alzheimer's disease in a French, genome-wide association study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20047743 2010 Enhanced circulating soluble LR11 in patients with coronary organic stenosis.
20015111 2010 GGA autoinhibition revisited.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19889475 2011 No replication of genetic association between candidate polymorphisms and Alzheimer's disease.
19889229 2009 Expression of SORL1 and a novel SORL1 splice variant in normal and Alzheimers disease brain.
19822782 2009 Implication of sex and SORL1 variants in italian patients with Alzheimer disease.
19653016 2010 Sequence variation in SORL1 and dementia risk in Swedes.
19584446 2009 A study of the SORL1 gene in Alzheimer's disease and cognitive function.
19539718 2009 SORL1 is genetically associated with Alzheimer disease in a Japanese population.
19368828 2009 Association of SORL1 gene variants with Alzheimer's disease.
19364927 2009 Brain traffic: subcellular transport of the amyloid precursor protein.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19077115 2009 Replication study of candidate genes for cognitive abilities: the Lothian Birth Cohort 1936.
19064752 2008 Association of distinct variants in SORL1 with cerebrovascular and neurodegenerative changes related to Alzheimer disease.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18938222 2008 Allelic mRNA expression of sortilin-1 (SORL1) mRNA in Alzheimer's autopsy brain tissues.
18830724 2009 Assessment of Alzheimer's disease case-control associations using family-based methods.
18713574 2008 The neuronal sortilin-related receptor gene SORL1 and late-onset Alzheimer's disease.
18685254 2008 Genetic association between SORL1 polymorphisms and Alzheimer's disease in a Japanese population.
18603531 2008 Endocytosis of apolipoprotein A-V by members of the low density lipoprotein receptor and the VPS10p domain receptor families.
18562096 2008 No association of SORL1 SNPs with Alzheimer's disease.
18541377 2008 Influence of SORL1 gene variants: association with CSF amyloid-beta products in probable Alzheimer's disease.
18407551 2008 SORL1 is genetically associated with increased risk for late-onset Alzheimer disease in the Belgian population.
18093545 2008 Alzheimer's disease: advances in trafficking.
18090307 2007 Association between SORL1 and Alzheimer's disease in a genome-wide study.
18063222 2009 SORL1 haplotypes modulate risk of Alzheimer's disease in Chinese.
17978276 2008 Association between genetic variants in SORL1 and autopsy-confirmed Alzheimer disease.
17975299 2008 Sorl1 as an Alzheimer's disease predisposition gene?
17949987 2008 SORL1 variants and risk of late-onset Alzheimer's disease.
17855360 2007 SorLA/LR11 regulates processing of amyloid precursor protein via interaction with adaptors GGA and PACS-1.
17826910 2007 Association between genetic variants in sortilin-related receptor 1 (SORL1) and Alzheimer's disease in adults with Down syndrome.
17721864 2007 Neuronal LR11/sorLA expression is reduced in mild cognitive impairment.
17589324 2007 Reduction of sortilin-1 in Alzheimer hippocampus and in cytokine-stressed human brain cells.
17420311 2007 The association between genetic variants in SORL1 and Alzheimer disease in an urban, multiethnic, community-based cohort.
17326667 2007 Apolipoprotein A-V interaction with members of the low density lipoprotein receptor gene family.
17220890 2007 The neuronal sortilin-related receptor SORL1 is genetically associated with Alzheimer disease.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16565469 2006 sorLA: sorting out APP.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16531402 2006 SorLA signaling by regulated intramembrane proteolysis.
16489755 2006 Molecular dissection of the interaction between amyloid precursor protein and its neuronal trafficking receptor SorLA/LR11.
16407538 2006 Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16174740 2005 Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15313836 2004 Loss of apolipoprotein E receptor LR11 in Alzheimer disease.
14764453 2004 LR11, an LDL receptor gene family member, is a novel regulator of smooth muscle cell migration.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12970790 2003 High level of cannabinoid receptor 1, absence of regulator of G protein signalling 13 and differential expression of Cyclin D1 in mantle cell lymphoma.
12530537 2002 Characterization of the VPS10 domain of SorLA/LR11 as binding site for the neuropeptide HA.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11821067 2002 The sorLA cytoplasmic domain interacts with GGA1 and -2 and defines minimum requirements for GGA binding.
11557679 2001 LR11, a mosaic LDL receptor family member, mediates the uptake of ApoE-rich lipoproteins in vitro.
11294867 2001 Activation and functional characterization of the mosaic receptor SorLA/LR11.
10375696 1999 Neuronal localization of a novel mosaic apolipoprotein E receptor, LR11, in rat and human brain.
9157966 1997 A novel mosaic protein containing LDL receptor elements is highly conserved in humans and chickens.
8940146 1996 Molecular characterization of a novel human hybrid-type receptor that binds the alpha2-macroglobulin receptor-associated protein.
8619474 1996 A "double adaptor" method for improved shotgun library construction.