Property Summary

NCBI Gene PubMed Count 36
PubMed Score 129.77
PubTator Score 113.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 7.1e-03
glioblastoma -1.200 3.2e-04
Atopic dermatitis -1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... 3.100 1.1e-04
interstitial cystitis -1.300 5.4e-05
psoriasis -1.500 1.7e-19
nasopharyngeal carcinoma 1.800 8.6e-03

Protein-protein Interaction (2)

Gene RIF (9)

PMID Text
24567419 One of the most striking changes involved sorbitol dehydrogenase, a key enzyme in the polyol pathway. Validation studies revealed dramatically increased sorbitol dehydrogenase concentrations and activity in adenomas and cancer cell lines, along with important changes in the expression of other enzymes in the same (AKR1B1) and related (KHK) pathways.
23850972 Thus, our findings suggest that the -888G > C polymorphism in the SORD gene is not involved in the pathogenesis of diabtic retinopathy in type 2 diabetes.
23452182 The SDH level was significantly decreased in patients with proliferative compared with non-proliferative retinopathy in both insulin and oral diabetic groups.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20372835 The expression of SORD is regulated by androgens in human prostate. In prostate cancer, increased immunostaining was associated with high Gleason patterns and high serum PSA concentrations.
19423711 The zinc-finger protein ZAC1 is up-regulated under hypertonic stress and negatively regulates expression of sorbitol dehydrogenase, allowing for accumulation of sorbitol as a compatible organic osmolyte.
17343568 Results compare the catalytic mechanism of liver sorbitol dehydrogenase with wild-type and Glu154-->Cys forms of yeast xylitol dehydrogenase.
14965227 Sorbitol dehydrogenase (SDH), a member of the medium-chain dehydrogenase/reductase protein family and the second enzyme of the polyol pathway of glucose metabolism, converts sorbitol to fructose strictly using NAD(+) as coenzyme.
12595725 crystals of sorbitol dehydrogenase belong to the monoclinic C2 space group, with unit-cell parameters a = 145.9, b = 52.3, c = 169.0 A, beta = 101.8 degrees

AA Sequence

MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGH      1 - 70
EASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFC     71 - 140
YKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRL    141 - 210
SKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMT    211 - 280
TVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKC    281 - 350
DPSDQNP                                                                   351 - 357
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24567419 2014 Sorbitol dehydrogenase overexpression and other aspects of dysregulated protein expression in human precancerous colorectal neoplasms: a quantitative proteomics study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23850972 2013 Association study of sorbitol dehydrogenase -888G>C polymorphism with type 2 diabetic retinopathy in Caucasian-Brazilians.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23452182 2013 Aldo-keto reductase and sorbitol dehydrogenase enzymes in Egyptian diabetic patients with and without proliferative diabetic retinopathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21557262 2011 Proteomic identification of exosomal LRG1: a potential urinary biomarker for detecting NSCLC.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20372835 2010 Sorbitol dehydrogenase expression is regulated by androgens in the human prostate.
19423711 2009 ZAC1 is up-regulated by hypertonicity and decreases sorbitol dehydrogenase expression, allowing accumulation of sorbitol in kidney cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17343568 2007 Catalytic mechanism of Zn2+-dependent polyol dehydrogenases: kinetic comparison of sheep liver sorbitol dehydrogenase with wild-type and Glu154-->Cys forms of yeast xylitol dehydrogenase.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16278369 Polyol pathway in human epididymis and semen.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14965227 2004 Sorbitol dehydrogenase: structure, function and ligand design.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12962626 2003 X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12595725 2003 Expression, purification and preliminary crystallographic analysis of human sorbitol dehydrogenase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9880675 1998 Structural and evolutionary characterization of the human sorbitol dehydrogenase gene duplication.
9183016 1997 Identification and characterisation of a sequence related to human sorbitol dehydrogenase.
8535074 1995 Molecular genetic analysis of the human sorbitol dehydrogenase gene.
8487505 1993 Membrane-bound sorbitol dehydrogenase in human red blood cells. Studies in normal subjects and in enzyme-deficient subjects with congenital cataracts.
8088829 1994 The human sorbitol dehydrogenase gene: cDNA cloning, sequence determination, and mapping by fluorescence in situ hybridization.
7782086 1995 Structural organization of the human sorbitol dehydrogenase gene (SORD).
7601136 1995 Cloning, sequencing, and determination of the sites of expression of mouse sorbitol dehydrogenase cDNA.
6870831 1983 Polyol-pathway enzymes of human brain. Partial purification and properties of sorbitol dehydrogenase.
6439573 1984 Aldose metabolism in developing human fetal brain and liver.
6177277 1982 Sorbitol dehydrogenase (EC.1.1.1.14) polymorphism in human seminal plasma.
3365415 1988 Purification and characterization of human liver sorbitol dehydrogenase.
2936393 1985 Molecular aspects of functional differences between alcohol and sorbitol dehydrogenases.
2691249 1989 Variability within mammalian sorbitol dehydrogenases. The primary structure of the human liver enzyme.