Property Summary

NCBI Gene PubMed Count 31
PubMed Score 28.69
PubTator Score 11.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.500 8.3e-07
oligodendroglioma 1.100 1.2e-02
psoriasis -1.400 7.1e-05
atypical teratoid / rhabdoid tumor 1.700 1.1e-04
glioblastoma 1.800 4.3e-05
active Crohn's disease -1.338 5.9e-03
active ulcerative colitis -1.271 2.2e-02
pediatric high grade glioma 1.300 9.0e-05
group 3 medulloblastoma -1.500 4.8e-04
inflammatory breast cancer -1.300 8.4e-03
COPD -1.400 3.0e-03

Gene RIF (9)

PMID Text
25972535 Taken together, the findings suggest that vinexin beta modulates NS5A phosphorylation via its interaction with NS5A, thereby regulating hepatitis C virus replication, implicating vinexin beta in the viral life cycle.
25824575 Our findings revealed that Vinexin-beta acts as a novel modulator of ischaemic injury
20361963 Vinexin knockdown using siRNA delayed migration of both HaCaT human keratinocytes and A431 epidermoid carcinoma cells in scratch assay but did not affect cell proliferation.
19294487 Rhotekin forms a complex with vinexin and may play a role at focal adhesions.
17486060 Vinexin is enriched at the leading edge of migrating cells, lamellipodia and and focal adhesions in well-spread cells.
16923119 These results suggest that vinexin beta plays a role in maintaining the phosphorylation of EGFR on the plasma membrane through the regulation of c-Cbl.
15734736 phosphorylation of the AF-1 domain controls RARgamma-mediated transcription through triggering the dissociation of vinexin beta
15184391 vinexin is a novel substrate of ERK2 and may play roles in ERK-dependent cell regulation
12510380 regulates cytoskeletal organization and signal transduction--review

AA Sequence

MQGPPRSLRAGLSLDDFIPGHLQSHIGSSSRGTRVPVIRNGGSNTLNFQFHDPAPRTVCNGGYTPRRDAS      1 - 70
QHPDPAWYQTWPGPGSKPSASTKIPASQHTQNWSATWTKDSKRRDKRWVKYEGIGPVDESGMPIAPRSSV     71 - 140
DRPRDWYRRMFQQIHRKMPDLQLDWTFEEPPRDPRHLGAQQRPAHRPGPATSSSGRSWDHSEELPRSTFN    141 - 210
YRPGAFSTVLQPSNQVLRRREKVDNVWTEESWNQFLQELETGQRPKKPLVDDPGEKPSQPIEVLLERELA    211 - 280
ELSAELDKDLRAIETRLPSPKSSPAPRRAPEQRPPAGPASAWSSSYPHAPYLGSARSLSPHKMADGGSPF    281 - 350
LGRRDFVYPSSTRDPSASNGGGSPARREEKKRKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEG    351 - 420
EHHGRLGIFPANYVEVLPADEIPKPIKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNEN    421 - 490
WYEGRITGTGRQGIFPASYVQVSREPRLRLCDDGPQLPTSPRLTAAARSARHPSSPSALRSPADPIDLGG    491 - 560
QTSPRRTGFSFPTQEPRPQTQNLGTPGPALSHSRGPSHPLDLGTSSPNTSQIHWTPYRAMYQYRPQNEDE    561 - 630
LELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPV                                 631 - 671
//

Text Mined References (44)

PMID Year Title
25972535 2015 Vinexin ? Interacts with Hepatitis C Virus NS5A, Modulating Its Hyperphosphorylation To Regulate Viral Propagation.
25824575 2015 Vinexin-? deficiency protects against cerebral ischaemia/reperfusion injury by inhibiting neuronal apoptosis.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20361963 2010 Crucial role of vinexin for keratinocyte migration in vitro and epidermal wound healing in vivo.
20205591 2010 Host determinants of HIV-1 control in African Americans.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19294487 2009 Interaction of a multi-domain adaptor protein, vinexin, with a Rho-effector, Rhotekin.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18662323 2008 Characterization of a multidomain adaptor protein, p140Cap, as part of a pre-synaptic complex.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17486060 2007 Essential roles of ERK-mediated phosphorylation of vinexin in cell spreading, migration and anchorage-independent growth.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16923119 2006 Vinexin beta regulates the phosphorylation of epidermal growth factor receptor on the cell surface.
16831423 2006 Abl kinase interacts with and phosphorylates vinexin.
16483316 2006 Protein kinase A-dependent increase in WAVE2 expression induced by the focal adhesion protein vinexin.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16374509 2006 Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome.
16302969 2005 SHIP2 interaction with the cytoskeletal protein Vinexin.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15734736 2005 Vinexin beta interacts with the non-phosphorylated AF-1 domain of retinoid receptor gamma (RARgamma) and represses RARgamma-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15242778 2004 The suppressor of cytokine signaling (SOCS)-7 interacts with the actin cytoskeleton through vinexin.
15184391 2004 Extracellular signal-regulated kinase activated by epidermal growth factor and cell adhesion interacts with and phosphorylates vinexin.
14627618 2003 Smooth muscle contraction and relaxation.
12660241 2003 SAFB2, a new scaffold attachment factor homolog and estrogen receptor corepressor.
12657639 2003 Interaction of lp-dlg/KIAA0583, a membrane-associated guanylate kinase family protein, with vinexin and beta-catenin at sites of cell-cell contact.
12510380 2002 [A novel adaptor protein family regulating cytoskeletal organization and signal transduction--Vinexin, CAP/ponsin, ArgBP2].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10585480 1999 Vinexin forms a signaling complex with Sos and modulates epidermal growth factor-induced c-Jun N-terminal kinase/stress-activated protein kinase activities.
9885244 1999 Vinexin: a novel vinculin-binding protein with multiple SH3 domains enhances actin cytoskeletal organization.