Property Summary

NCBI Gene PubMed Count 49
PubMed Score 35.56
PubTator Score 23.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.579 5.9e-03
adult high grade glioma -1.400 8.3e-03
astrocytic glioma -1.800 2.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.510 2.9e-04
Breast cancer -2.300 3.4e-02
breast carcinoma -1.200 4.5e-14
cystic fibrosis -4.932 9.4e-08
glioblastoma -1.400 4.4e-05
intraductal papillary-mucinous adenoma (... -1.200 1.4e-03
intraductal papillary-mucinous carcinoma... -1.300 1.5e-03
invasive ductal carcinoma -1.022 3.0e-02
juvenile dermatomyositis 1.130 1.6e-07
lung carcinoma 1.900 8.1e-21
medulloblastoma -1.300 1.4e-02
medulloblastoma, large-cell -2.400 8.6e-03
nasopharyngeal carcinoma -1.500 8.5e-07
non primary Sjogren syndrome sicca -1.200 6.7e-03
non-small cell lung cancer -1.897 6.6e-12
oligodendroglioma -2.000 2.8e-02
osteosarcoma -1.408 8.4e-05
ovarian cancer -2.100 1.3e-12
pancreatic cancer -1.100 1.2e-02
pancreatic ductal adenocarcinoma liver m... -1.200 4.6e-02
pituitary cancer -2.200 5.0e-07
psoriasis -1.100 2.0e-06
subependymal giant cell astrocytoma -2.312 4.0e-02

Gene RIF (21)

AA Sequence

MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAP      1 - 70
HYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPA     71 - 140
AKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDRKVDTRKFRSEPR    141 - 210
SIFEYEPGKSSILQHERPASLYQSSIDRSLERPMSSASMASDFRKRRKSEPAVGPPRGLGDQSASRTSPG    211 - 280
RVDLPGSSTTLTKSFTSSSPSSPSRAKGGDDSKICPSLCSYSGLNGNPSSELDYCSTYRQHLDVPRDSPR    281 - 350
AISFKNGWQMARQNAEIWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKVKSESMGSLLCEEDSKESCPM    351 - 420
AWGSPYVPEVRSNGRSRIRHRSARNAPGFLKMYKKMHRINRKDLMNSEVICSVKSRILQYESEQQHKDLL    421 - 490
RAWSQCSTEEVPRDMVPTRISEFEKLIQKSKSMPNLGDDMLSPVTLEPPQNGLCPKRRFSIEYLLEEENQ    491 - 560
SGPPARGRRGCQSNALVPIHIEVTSDEQPRAHVEFSDSDQDGVVSDHSDYIHLEGSSFCSESDFDHFSFT    561 - 630
SSESFYGSSHHHHHHHHHHHRHLISSCKGRCPASYTRFTTMLKHERARHENTEEPRRQEMDPGLSKLAFL    631 - 700
VSPVPFRRKKNSAPKKQTEKAKCKASVFEALDSALKDICDQIKAEKKRGSLPDNSILHRLISELLPDVPE    701 - 770
RNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPR    771 - 840
SYSSTLTDMGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVG    841 - 910
IFPISYVEKLTPPEKAQPARPPPPAQPGEIGEAIAKYNFNADTNVELSLRKGDRVILLKRVDQNWYEGKI    911 - 980
PGTNRQGIFPVSYVEVVKKNTKGAEDYPDPPIPHSYSSDRIHSLSSNKPQRPVFTHENIQGGGEPFQALY    981 - 1050
NYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL                       1051 - 1100
//

Text Mined References (56)

PMID Year Title