Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.23
PubTator Score 9.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
urothelial carcinoma -1.600 2.9e-02
medulloblastoma, large-cell 1.400 9.1e-05
lung cancer 4.400 1.1e-06
colon cancer -1.200 2.4e-03
interstitial cystitis -1.400 3.8e-02
adult high grade glioma 1.200 3.3e-03
sonic hedgehog group medulloblastoma 1.300 3.2e-02
subependymal giant cell astrocytoma 1.343 4.0e-02

Gene RIF (5)

PMID Text
26375665 the expression of Sohlh genes in human tissues
25463635 The polymorphisms rs1328626 and rs6563386 of the SOHLH2 gene would be the genetic risk factors for nonobstructive azoospermia in the Chinese population. The SNP rs1328641 might influence testes development in the NOA patients.
24858206 Low Sohlh2 expression is associated with ovarian cancer.
24524832 Our identification of novel variants in the SOHLH2 gene, in women with POF of both Chinese and Serbian origin, strongly suggests an important role for SOHLH2 in human POF etiology.
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLL      1 - 70
KVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCP     71 - 140
SNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKE    141 - 210
KLRRERIKYCCEQLRTLLPYVKGRKNDAASVLEATVDYVKYIREKISPAVMAQITEALQSNMRFCKKQQT    211 - 280
PIELSLPGTVMAQRENSVMSTYSPERGLQFLTNTCWNGCSTPDAESSLDEAVRVPSSSASENAIGDPYKT    281 - 350
HISSAALSLNSLHTVRYYSKVTPSYDATAVTNQNISIHLPSAMPPVSKLLPRHCTSGLGQTCTTHPNCLQ    351 - 420
QFWAY                                                                     421 - 425
//

Text Mined References (17)

PMID Year Title
26869299 2016 SOHLH2 is essential for synaptonemal complex formation during spermatogenesis in early postnatal mouse testes.
26375665 2015 Immunohistochemical Study of Expression of Sohlh1 and Sohlh2 in Normal Adult Human Tissues.
25463635 2015 Association of genetic variants in SOHLH1 and SOHLH2 with non-obstructive azoospermia risk in the Chinese population.
24858206 2014 Sohlh2 inhibits ovarian cancer cell proliferation by upregulation of p21 and downregulation of cyclin D1.
24524832 2014 Novel variants in the SOHLH2 gene are implicated in human premature ovarian failure.
23346521 2012 Transcription factors in the maintenance and survival of primordial follicles.
22566634 2012 The genetic architecture of economic and political preferences.
21296871 2011 Coordinated cancer germline antigen promoter and global DNA hypomethylation in ovarian cancer: association with the BORIS/CTCF expression ratio and advanced stage.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
17967063 2007 Genome-wide profiling of DNA methylation reveals a class of normally methylated CpG island promoters.
17305537 2007 Candidate genes for premature ovarian failure.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.