Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11
PubTator Score 0.13

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


AA Sequence

QMFQPIILLILILVLFSSLSYTTIFKLVFLFTLFFVL                                     911 - 947

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.