Property Summary

NCBI Gene PubMed Count 802
PubMed Score 470.08
PubTator Score 2137.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Acute coronary syndrome 39 0.0 0.0
Adenocarcinoma 122 0.0 0.0
Adenocarcinoma of lung 142 0.0 0.0
Adenomatous Polyposis Coli 16 0.0 0.0
Adrenoleukodystrophy 29 0.0 0.0
Albuminuria 21 0.0 0.0
Alveolitis, Extrinsic Allergic 1 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Amyotrophic lateral sclerosis 451 0.0 0.0
Anemia 365 0.0 0.0
Anemia, Sideroblastic 7 0.0 0.0
Aortic Aneurysm, Abdominal 9 0.0 0.0
Aortic Diseases 6 0.0 0.0
Arsenic Poisoning 62 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Asphyxia neonatorum 11 0.0 0.0
Atherosclerosis 291 0.0 0.0
Autoimmune Diseases 67 0.0 0.0
Brain Injuries 65 0.0 0.0
Brain Ischemia 110 0.0 0.0
Brain Neoplasms 33 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Carcinoma 11493 0.0 0.0
Carcinoma, Ductal, Breast 11 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Carcinoma, Renal Cell 124 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Carcinoma, squamous cell of head and neck 31 0.0 0.0
Cardiomegaly 116 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Cardiomyopathy, Dilated 83 0.0 0.0
Cataract and cardiomyopathy 3 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Central Nervous System Diseases 4 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Depressive Disorder, Major 19 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetes, Gestational 9 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Disease Progression 136 0.0 0.0
Endotoxemia 8 0.0 0.0
Enterocolitis, Necrotizing 17 0.0 0.0
Esophageal Neoplasms 69 0.0 0.0
Esophageal Squamous Cell Carcinoma 77 0.0 0.0
Esophageal Stenosis 15 0.0 0.0
Esophagitis 35 0.0 0.0
Farber lipogranulomatosis 9 0.0 0.0
Fatty Liver 70 0.0 0.0
Fever 138 0.0 0.0
Fibrosis 44 0.0 0.0
Granuloma, Respiratory Tract 2 0.0 0.0
Heart failure 162 0.0 0.0
Hypertension 396 0.0 0.0
Hypertension, Pulmonary 37 0.0 0.0
Hyperthyroidism 53 0.0 0.0
Hypoglycemia 152 0.0 0.0
Hypoxia 33 0.0 0.0
Infarction, Middle Cerebral Artery 33 0.0 0.0
Infertility, Male 46 0.0 0.0
Insulin Resistance 72 0.0 0.0
Ischemia 28 0.0 0.0
Ischemic Attack, Transient 10 0.0 0.0
Kidney Diseases 114 0.0 0.0
Kidney Neoplasms 37 0.0 0.0
Kidney Tubular Necrosis, Acute 4 0.0 0.0
Lewy Body Disease 21 0.0 0.0
Liver Cirrhosis, Alcoholic 16 0.0 0.0
Lung Diseases, Interstitial 5 0.0 0.0
Lung diseases 50 0.0 0.0
Lymphatic Metastasis 15 0.0 0.0
Lymphoma, Large B-Cell, Diffuse 34 0.0 0.0
MELAS syndrome 18 0.0 0.0
MICROVASCULAR COMPLICATIONS OF DIABETES, SUSCEPTIBILITY TO, 6 1 0.0 0.0
Mammary Neoplasms, Experimental 154 0.0 0.0
Marfan Syndrome 15 0.0 0.0
Meningomyelocele 6 0.0 0.0
Mesothelioma 38 0.0 0.0
Mesothelioma, Malignant 105 0.0 0.0
Methylmalonic acidemia 37 0.0 0.0
Mitochondrial Diseases 9 0.0 0.0
Mouth Neoplasms 55 0.0 0.0
Multiple chemical sensitivity 6 0.0 0.0
Multiple myeloma 1332 0.0 0.0120117523794241
Myocardial Infarction 151 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Necrosis 53 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasms 63 0.0 0.0
Nephrotic Syndrome 78 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Neurodegenerative Diseases 38 0.0 0.0
Obesity 678 0.0 0.0
Ophthalmoplegia, Chronic Progressive External 5 0.0 0.0
Osteoarthritis 184 0.0 0.0
Osteoporosis 363 0.0 0.0
Ovarian Neoplasms 102 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Papilloma 44 0.0 0.0
Parkinson Disease 64 0.0 0.0
Peripheral Nervous System Diseases 52 0.0 0.0
Precancerous Conditions 80 0.0 0.0
Premature Birth 77 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Psychoses, Substance-Induced 17 0.0 0.0
Radiation Injuries 1 0.0 0.0
Radiation Injuries, Experimental 11 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Respiratory Distress Syndrome, Adult 40 0.0 0.0
Reticulocytosis 20 0.0 0.0
Seizures 596 0.0 0.0
Shock, Cardiogenic 3 0.0 0.0
Skin Abnormalities 37 0.0 0.0
Skin Diseases 71 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Thyroid Carcinoma, Anaplastic 1 0.0 0.0
Tongue Neoplasms 8 0.0 0.0
Turner syndrome 28 0.0 0.0
Urinary Bladder Neoplasms 114 0.0 0.0
Uveitis 103 0.0 0.0
Vascular Diseases 16 0.0 0.0
Ventricular Dysfunction, Left 22 0.0 0.0
nasopharyngeal carcinoma 1058 0.0 0.0
pancreatic carcinoma 562 0.0 0.0
psoriasis 6694 0.0 5.21367449121065E-8
sarcoidosis 370 0.0 0.0
Disease Target Count Z-score Confidence
Eye disease 62 0.0 2.2

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid arthritis 2.800 1.6e-03
Bipolar Disorder 1.200 4.0e-02
Multiple myeloma 1.355 1.2e-02
psoriasis 2.200 5.2e-08
malignant mesothelioma -1.300 1.3e-06
active Crohn's disease 1.272 1.8e-02
acute quadriplegic myopathy 2.043 5.8e-05
adult high grade glioma 1.600 1.5e-02
Breast cancer -1.200 1.4e-06
chronic lymphosyte leukemia -1.100 2.4e-08
cutaneous lupus erythematosus 1.900 4.1e-04
cystic fibrosis 1.143 1.3e-03
dermatomyositis 1.400 1.0e-02
ependymoma 1.700 2.9e-02
glioblastoma 1.700 1.6e-03
head and neck cancer 1.700 1.4e-04
head and neck cancer and chronic obstruc... 1.100 1.0e-02
interstitial cystitis 1.600 6.1e-04
intraductal papillary-mucinous adenoma (... -1.100 4.6e-02
invasive ductal carcinoma 1.200 7.4e-03
lung cancer -5.000 2.6e-05
lung carcinoma -1.600 4.5e-11
ovarian cancer -2.100 6.8e-07
primary Sjogren syndrome 1.100 3.8e-02
tuberculosis -4.000 8.1e-05
ulcerative colitis 1.500 1.6e-02
urothelial carcinoma -1.300 1.3e-02

Protein-protein Interaction (1)

PDB (30)

Gene RIF (786)

AA Sequence

MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQ      1 - 70
EALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASV     71 - 140
GVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW    141 - 210
ENVTERYMACKK                                                              211 - 222
//

Text Mined References (809)

PMID Year Title