Property Summary

NCBI Gene PubMed Count 963
PubMed Score 1972.07
PubTator Score 5448.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 8.441 4.0
Down syndrome 499 4.254 2.1
Muscular atrophy 71 3.654 1.8
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Anemia, Iron-Deficiency 4 0.0 0.0
Aortic Diseases 6 0.0 0.0
Asphyxia neonatorum 11 0.0 0.0
Asthma 385 0.0 0.0
Atherosclerosis 291 0.0 0.0
Brain Ischemia 110 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Deficiency Diseases 3 0.0 0.0
Depressive disorder 409 0.0 0.0
Dermatitis, Contact 71 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic retinopathy 56 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Fatty Liver 70 0.0 0.0
Fatty Liver, Alcoholic 3 0.0 0.0
Fetal Growth Retardation 189 0.0 0.0
Gait Disorders, Neurologic 3 0.0 0.0
Glioma 74 0.0 0.0
Hearing Loss 17 0.0 0.0
Heart failure 162 0.0 0.0
Hemolysis 6 0.0 0.0
Hepatitis, Chronic 23 0.0 0.0
Hypertension 396 0.0 0.0
Hyperthyroidism 53 0.0 0.0
Hypotension 82 0.0 0.0
Hypothermia 12 0.0 0.0
Inflammation 120 0.0 0.0
Ischemia 28 0.0 0.0
Ischemic Attack, Transient 10 0.0 0.0
Kidney Calculi 7 0.0 0.0
Liver diseases 87 0.0 0.0
MELAS syndrome 18 0.0 0.0
Marfan Syndrome 15 0.0 0.0
Meningomyelocele 6 0.0 0.0
Motor neuron disease 49 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Necrosis 53 0.0 0.0
Nephrosis 21 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Nervous System Diseases 53 0.0 0.0
Obesity 678 0.0 0.0
Ophthalmoplegia, Chronic Progressive External 5 0.0 0.0
Ovarian Neoplasms 102 0.0 0.0
Parkinson Disease 64 0.0 0.0
Protein Deficiency 3 0.0 0.0
Proteinuria 144 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Radiation Injuries, Experimental 11 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Retinal Degeneration 106 0.0 0.0
Schistosomiasis mansoni 3 0.0 0.0
Scrapie 17 0.0 0.0
Spinal Cord Injuries 8 0.0 0.0
Stroke 33 0.0 0.0
Turner syndrome 28 0.0 0.0
Ureteral Calculi 4 0.0 0.0
Weight Loss 24 0.0 0.0
diabetes mellitus 1728 0.0 0.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 2.221 2.5e-04
ovarian cancer -1.400 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.429 3.0e-02
Waldenstrons macroglobulinemia 1.216 1.1e-02

Protein-protein Interaction (5)

PDB (96)

Gene RIF (898)

AA Sequence

MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR      1 - 70
KHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGN     71 - 140
AGSRLACGVIGIAQ                                                            141 - 154
//

Text Mined References (980)

PMID Year Title