Property Summary

NCBI Gene PubMed Count 29
PubMed Score 42.53
PubTator Score 28.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.900 4.5e-05
astrocytic glioma -1.300 2.0e-02
Astrocytoma, Pilocytic -1.300 2.8e-06
atypical teratoid / rhabdoid tumor -1.500 7.6e-05
ependymoma -1.100 3.2e-02
glioblastoma -1.400 1.0e-06
lung cancer 1.100 3.9e-02
malignant mesothelioma 1.300 1.9e-04
osteosarcoma 2.260 8.5e-08
ovarian cancer -1.500 2.8e-06
subependymal giant cell astrocytoma -1.990 4.8e-02

Gene RIF (13)

AA Sequence

MVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAG      1 - 70
PGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGLESEAESLETNSCSEEELSSP     71 - 140
GRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGEQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSF    141 - 210
KIRLSRLFRTKSCNGGSGGGDGTGKRPSGELAASAASLTDMGGSAGRELDAGRKPKLTRTQSAFSPVSFS    211 - 280
PLFTGETVSLVDVDISQRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPP    281 - 350
HAPDAFPRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDG    351 - 420
SFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYF    421 - 490
LRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEV    491 - 560
YLSLKEAQLISKQKQEVEPST                                                     561 - 581
//

Text Mined References (29)

PMID Year Title