Property Summary

NCBI Gene PubMed Count 28
PubMed Score 102.45
PubTator Score 71.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.500 5.6e-07
astrocytic glioma -1.200 2.1e-02
osteosarcoma 1.908 3.0e-05
lung cancer 1.400 6.5e-03
Breast cancer 2.500 2.6e-02
subependymal giant cell astrocytoma -2.861 6.0e-03
spina bifida -1.758 4.0e-02
ovarian cancer -1.600 1.4e-05

Synonym

Accession O75159 Q53SD4 Q8IYZ4 SOCS-5
Symbols CIS6
CISH6
Cish5
SOCS-5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

Protein-protein Interaction (1)

Gene RIF (11)

PMID Text
25017311 Opisthorchis felineus infection diminishes the risk of atopic bronchial asthma associated with the SOCS5 gene polymorphism.
24340963 The rs6737848 SOCS5 polymorphism was significantly associated with asthma in additive model and in dominant model
23990909 different domains in SOCS5 contribute to two distinct mechanisms for regulation of cytokine and growth factor signaling with JAK1 and SHC-1
22773185 Exogenous miR-9 effectively reduced SOCS5 levels, leading to activated JAK-STAT pathway, which promoted endothelial cell migration and tumour angiogenesis
22423360 Identified is a conserved region of about 70 residues in the N-terminal domains of SOCS4 and 5 that is predicted to be more ordered than the surrounding sequence.
22081311 The results may contribute to understanding SOCS5 and SOCS6 expression regulation in various cancer tissues, and show that these two factors may be used for diagnosing cancer.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20802378 Observational study of genetic testing. (HuGE Navigator)
20137421 Up regulation of SOCS1 and SOCS5 expression and down-regulation of SOCS3 and CIS may correlate with the development of a Th1 mediated immune response in Vogt-Koyanagi-Harada disease.
16210657 Constitutive expression of SOCS5 in transgenic mice results in reduced eosinophil infiltration in allergic conjunctivitis
15590694 The reduction in EGFR levels and EGF-induced signaling in SOCS5-expressing cells requires both the Src homology-2 and SOCS box domains of SOCS5.

AA Sequence

MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLRENIALQLGLS      1 - 70
PSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPWGGKKKHSCSTKTQSSLDADK     71 - 140
KFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHL    141 - 210
SELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPP    211 - 280
NAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTH    281 - 350
VSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR    351 - 420
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRA    421 - 490
VICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK                            491 - 536
//

Text Mined References (30)

PMID Year Title
25017311 2014 Opisthorchis felineus liver fluke invasion is an environmental factor modifying genetic risk of atopic bronchial asthma.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24340963 2013 [Association of polymorphism Rs6737848 in the Socs5 gene with bronchial asthma].
24255059 2014 Inhibition of microRNA-92a prevents endothelial dysfunction and atherosclerosis in mice.
23990909 2013 Suppressor of Cytokine Signaling (SOCS) 5 utilises distinct domains for regulation of JAK1 and interaction with the adaptor protein Shc-1.
22773185 2012 Tumour-secreted miR-9 promotes endothelial cell migration and angiogenesis by activating the JAK-STAT pathway.
22423360 2012 The N-terminal domains of SOCS proteins: a conserved region in the disordered N-termini of SOCS4 and 5.
22081311 2012 SOCS5 and SOCS6 have similar expression patterns in normal and cancer tissues.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20137421 2009 [Expression of suppressor of cytokine signaling in peripheral blood monocular cells of patients with Vogt-Koyanagi-Harada disease].
16210657 2005 The control of allergic conjunctivitis by suppressor of cytokine signaling (SOCS)3 and SOCS5 in a murine model.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15590694 2005 Suppressors of cytokine signaling 4 and 5 regulate epidermal growth factor receptor signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14707129 2004 Suppressor of cytokine signaling 6 associates with KIT and regulates KIT receptor signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242343 2002 Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11837794 2002 Suppressors of cytokine signaling (SOCS): inhibitors of the JAK/STAT pathway.
11835308 2002 Cytokine signaling in the brain: putting a SOCS in it?
11553846 2001 SOCS proteins: negative regulators of cytokine signaling.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10773671 2000 Cloning and expression of CIS6, chromosome assignment to 3p22 and 2p21 by in situ hybridization.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9419338 1998 Twenty proteins containing a C-terminal SOCS box form five structural classes.