Property Summary

NCBI Gene PubMed Count 83
PubMed Score 772.51
PubTator Score 367.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma -3.700 2.2e-06
glioblastoma 1.800 1.5e-03
posterior fossa group B ependymoma 3.200 4.2e-09
group 4 medulloblastoma 3.000 2.5e-09
atypical teratoid / rhabdoid tumor 1.200 2.4e-02
medulloblastoma, large-cell 3.200 2.1e-03
primitive neuroectodermal tumor 1.600 5.6e-04
adrenocortical carcinoma -1.495 3.7e-03
tuberculosis 1.300 1.4e-05
pancreatic ductal adenocarcinoma liver m... -1.181 8.9e-03
non-small cell lung cancer -2.143 1.9e-17
intraductal papillary-mucinous adenoma (... -2.600 6.2e-05
intraductal papillary-mucinous carcinoma... -2.000 8.3e-04
intraductal papillary-mucinous neoplasm ... -3.200 1.2e-03
lung cancer -6.200 5.0e-06
colon cancer -1.100 1.5e-02
cystic fibrosis 1.500 1.0e-04
lung adenocarcinoma -2.300 2.1e-09
adult high grade glioma 2.200 9.3e-04
pilocytic astrocytoma 1.900 8.8e-06
invasive ductal carcinoma -1.893 2.1e-03
psoriasis -1.300 6.5e-08
Breast cancer -2.700 6.6e-08
lung carcinoma -1.300 7.4e-09
breast carcinoma -1.100 2.3e-18
ulcerative colitis -1.200 1.2e-03
ovarian cancer -1.700 7.6e-08

Protein-protein Interaction (3)

Gene RIF (55)

PMID Text
27071013 SOCS2 may improve outcome of TBI in mice by regulating aspects of the neuroinflammatory response
26709655 focus on SOCS2 and review its biological function as well as its implication in pathological processes
26121586 crystals of SOCS2 in complex with its adaptor proteins, Elongin C and Elongin B, underwent a change in crystallographic parameters when treated with dimethyl sulfoxide during soaking experiments.
25561270 miR-101 functions as a growth-suppressive miRNA in H. pylori related GC, and that its suppressive effects are mediated mainly by repressing SOCS2 expression.
25286386 This study showed that there was significantly increased levels of SOCS-2 mRNA in elderly and Alzheimer's disease brains.
25283341 This study shows that over-expression of SOCS2 reduces the psychostimulant effects of amphetamine, enhances PPI, and alters mesolimbic dopaminergic activity.
25025962 Stage-independent downregulation of SOCS2 and SOCS6 correlate with disease-free survival in colorectal cancer.
24905066 The SOCS2 polymorphism (rs3782415) has an influence on the adult height of children with Turner syndrome and growth hormone deficiency after long-term therapy.
24559289 our study indicates that high SOCS2 expression is associated with poor survival in pediatric AML.
24280133 SOCS2 correlates with malignancy and exerts growth-promoting effects in prostate cancer.
24131863 methylation of SOCS1, SOCS2, SOCS3 and CISH is infrequent in Ph-ve MPN.
24031028 SOCS2 mediates the cross talk between androgen and growth hormone signaling in prostate cancer.
23898208 HIV-1 Tat upregulates the expression of suppressor of cytokine signaling 2 (SOCS2) in human primary T cells
23897481 crystal structure shows interaction between SOCS2-elongin BC and Cullin-5
23567159 Estradiol can amplify GH intracellular signaling in human osteoblasts with an essential role played by the reduction of the SOCS2 mediated feedback loop.
23548639 SOCS2 associates with activated FLT3 through phosphotyrosine residues 589 and 919, and co-localizes with FLT3 in the cell membrane.
23475171 SOCS2 and SOCS6 expression are remarkably reduced in hepatocellular carcinoma and correlate with aggressive tumor progression and poor prognosis
22795647 Simultaneous stimulation of monocyte-derived DCs resulted in highly increased production of IL-1beta, IL-23 and SOCS2.
22768656 High SOCS2 is associated with idiopathic short stature.
22745742 Data demonstrated that suppressor of cytokine signaling 2 (SOCS2) protein level was distinctively increased by saponin, which in turn resulted in inhibition of HCV replication.
22291912 LPS regulates SOCS2 transcription in a type I interferon dependent autocrine-paracrine loop.
21844389 We propose a model in which SOCS2 acts as a negative regulator of TLR-induced dendritic cell activation
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20802378 Observational study of genetic testing. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20543098 Data show that knockdown of SOCS2 resulted in the accumulation of p-Pyk2(Tyr402) and blocked NK cell effector functions.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20136974 Probiotic administration increased expression of SOCS-2 and SOCS-3 in Helicobacter pylori infection to limit inflammatory signaling.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19779605 SOCS2 is required for appropriate TLR4 signaling in maturating human DCs via both the MyD88-dependent and -independent signaling pathway
19423540 Observational study of gene-disease association. (HuGE Navigator)
19279332 role of SOCS-2 in mediating HIV-1-induced immune evasion and dysregulation of IFNgamma signaling in primary human monocytes
19279332 HIV-1 Tat upregulates the expression of suppressor of cytokine signaling 2 (SOCS2) in human primary T cells
19266077 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18844680 Acromegalic patients with active disease and hyperplastic polyps had higher levels of SOCS2 transcripts.
18820827 difference in SOCS1, SOCS2 and SOCS3 transcript levels between normal individuals and SLE patients is not statistically significant
18769447 SOCS2 epigenetic downregulation might be an important second step in the genesis of cytokine-independent myeloproliferative disorder clones
17703412 Observational study of gene-disease association. (HuGE Navigator)
17666591 analysis of STAT5, CIS, and SOCS2 interactions with the growth hormone receptor
17651480 Favorable prognostic value of high SOCS2 expression in primary mammary carcinomas.
17325857 A defect in expression of SOCS-2 and SOCS-3 genes may be crucial for the IGF-I hypersensitivity and progressive increase in erythroid cell population size characteristic of Polycythemia vera.
17264307 Using RT-PCR, we demonstrated for the first time that neutrophils express mRNA for SOCS-2.
17008382 SOCS2 expression is regulated by STAT5.
16684815 SOCS2 only interacts with the Y1077 motif, but with higher binding affinity and can interfere with CIS and STAT5a prey recruitment at this site.
16675548 Results describe the 1.9-A crystal structure of the ternary complex of SOCS2 with elongin C and elongin B.
16406727 Observational study of gene-disease association. (HuGE Navigator)
16406727 Association of single-nucleotide polymorphisms in the SOCS2 gene with type 2 diabetes in the Japanese was studied.
15361843 SOCS1 and SOCS2 but not SOCS3 suppressed the growth of ovarian and breast cancer cells.
12552091 SOCS2 mediates the suppression of JAK2 phosphorylation by estrogen, which inhibits growth hormone signaling
11861294 SOCS-2 is overexpressed in advanced stages of chronic myeloid leukemia. It may be a component of a negative feedback mechanism that is functioning inadequately, induced by Bcr-Abl but unable to reverse its growth-promoting effects.

AA Sequence

MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTF      1 - 70
LIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGP     71 - 140
EAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV                141 - 198
//

Text Mined References (86)

PMID Year Title
27071013 2016 Suppressor of Cytokine Signaling-2 (SOCS2) Regulates the Microglial Response and Improves Functional Outcome after Traumatic Brain Injury in Mice.
26709655 2016 SOCS2: physiological and pathological functions.
26121586 2015 Serendipitous SAD Solution for DMSO-Soaked SOCS2-ElonginC-ElonginB Crystals Using Covalently Incorporated Dimethylarsenic: Insights into Substrate Receptor Conformational Flexibility in Cullin RING Ligases.
25561270 2015 MiR-101 inhibits cell growth and tumorigenesis of Helicobacter pylori related gastric cancer by repression of SOCS2.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25286386 2015 Expression of suppressor of cytokine signaling genes in human elderly and Alzheimer's disease brains and human microglia.
25283341 2015 Dopaminergic activity and behaviour in SOCS2 transgenic mice: Revealing a potential drug target for schizophrenia.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
25025962 2014 Identification of SOCS2 and SOCS6 as biomarkers in human colorectal cancer.
24905066 2014 Genetic predictors of long-term response to growth hormone (GH) therapy in children with GH deficiency and Turner syndrome: the influence of a SOCS2 polymorphism.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24559289 2014 High expression of suppressor of cytokine signaling-2 predicts poor outcome in pediatric acute myeloid leukemia: a report from the Children's Oncology Group.
24280133 2014 SOCS2 correlates with malignancy and exerts growth-promoting effects in prostate cancer.
24131863 2013 Methylation profiling of SOCS1, SOCS2, SOCS3, CISH and SHP1 in Philadelphia-negative myeloproliferative neoplasm.
24031028 2014 SOCS2 mediates the cross talk between androgen and growth hormone signaling in prostate cancer.
23897481 2013 Structural basis of intersubunit recognition in elongin BC-cullin 5-SOCS box ubiquitin-protein ligase complexes.
23567159 2013 17?-Estradiol positively modulates growth hormone signaling through the reduction of SOCS2 negative feedback in human osteoblasts.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23548639 2013 Suppressor of cytokine signaling 2 (SOCS2) associates with FLT3 and negatively regulates downstream signaling.
23475171 2013 Reduced expression of SOCS2 and SOCS6 in hepatocellular carcinoma correlates with aggressive tumor progression and poor prognosis.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22795647 2013 TLR8 and NOD signaling synergistically induce the production of IL-1? and IL-23 in monocyte-derived DCs and enhance the expression of the feedback inhibitor SOCS2.
22768656 2012 Expression of SOCS1, SOCS2, and SOCS3 in growth hormone-stimulated skin fibroblasts from children with idiopathic short stature.
22745742 2012 Saponin inhibits hepatitis C virus propagation by up-regulating suppressor of cytokine signaling 2.
22291912 2012 LPS regulates SOCS2 transcription in a type I interferon dependent autocrine-paracrine loop.
21844389 2011 Suppressor of cytokine signaling 2 is a feedback inhibitor of TLR-induced activation in human monocyte-derived dendritic cells.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20543098 2010 Suppressor of cytokine signaling 2 regulates IL-15-primed human NK cell function via control of phosphorylated Pyk2.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20136974 2010 Anti-inflammatory actions of probiotics through activating suppressor of cytokine signaling (SOCS) expression and signaling in Helicobacter pylori infection: a novel mechanism.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19779605 2009 SOCS2 influences LPS induced human monocyte-derived dendritic cell maturation.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19279332 2009 HIV-1 transactivator protein induction of suppressor of cytokine signaling-2 contributes to dysregulation of IFN{gamma} signaling.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19159283 2009 Array MAPPIT: high-throughput interactome analysis in mammalian cells.
18844680 2009 Changes in the expression of suppressor of cytokine signalling (SOCS) 2 in the colonic mucosa of acromegalic patients are associated with hyperplastic polyps.
18820827 2008 The analysis of CIS, SOCS1, SOSC2 and SOCS3 transcript levels in peripheral blood mononuclear cells of systemic lupus erythematosus and rheumatoid arthritis patients.
18769447 2008 SOCS2: inhibitor of JAK2V617F-mediated signal transduction.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17666591 2007 Mammalian protein-protein interaction trap (MAPPIT) analysis of STAT5, CIS, and SOCS2 interactions with the growth hormone receptor.
17651480 2007 Favorable prognostic value of SOCS2 and IGF-I in breast cancer.
17325857 2007 Overexpression of SOCS-2 and SOCS-3 genes reverses erythroid overgrowth and IGF-I hypersensitivity of primary polycythemia vera (PV) cells.
17264307 2007 Molecular mechanisms involved in interleukin-4-induced human neutrophils: expression and regulation of suppressor of cytokine signaling.
17008382 2007 In vivo transcript profiling and phylogenetic analysis identifies suppressor of cytokine signaling 2 as a direct signal transducer and activator of transcription 5b target in liver.
16684815 2006 A complex interaction pattern of CIS and SOCS2 with the leptin receptor.
16675548 2006 Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase.
16643902 2006 The E3 ubiquitin ligase HOIL-1 induces the polyubiquitination and degradation of SOCS6 associated proteins.
16406727 2006 Association of single-nucleotide polymorphisms in the suppressor of cytokine signaling 2 (SOCS2) gene with type 2 diabetes in the Japanese.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16199887 2005 SOCS2 can enhance interleukin-2 (IL-2) and IL-3 signaling by accelerating SOCS3 degradation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16097082 2005 Assignment of suppressor of cytokine signalling-2 (SOCS2) to porcine chromosome 5 with radiation hybrids.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361843 2004 Differential hypermethylation of SOCS genes in ovarian and breast carcinomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12552091 2003 Estrogen inhibits GH signaling by suppressing GH-induced JAK2 phosphorylation, an effect mediated by SOCS-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135564 2002 Recombinant human CIS2 (SOCS2) protein: subcloning, expression, purification, and characterization.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11889171 2002 Identification of suppressors of cytokine signaling (SOCS) proteins in human gestational tissues: differential regulation is associated with the onset of labor.
11861294 2002 Overexpression of SOCS-2 in advanced stages of chronic myeloid leukemia: possible inadequacy of a negative feedback mechanism.
11835308 2002 Cytokine signaling in the brain: putting a SOCS in it?
11781573 2001 Design and application of a cytokine-receptor-based interaction trap.
11034314 2000 IL-10 attenuates IFN-alpha-activated STAT1 in the liver: involvement of SOCS2 and SOCS3.
10890450 2000 Gigantism in mice lacking suppressor of cytokine signalling-2.
10585430 1999 SOCS/CIS protein inhibition of growth hormone-stimulated STAT5 signaling by multiple mechanisms.
10512686 1999 Radiation hybrid and cytogenetic mapping of SOCS1 and SOCS2 to chromosomes 16p13 and 12q, respectively.
10455112 1999 Inhibition and restoration of prolactin signal transduction by suppressors of cytokine signaling.
10453981 1999 Differential regulation of signaling pathways for insulin and insulin-like growth factor I.
9727029 1998 Interaction of human suppressor of cytokine signaling (SOCS)-2 with the insulin-like growth factor-I receptor.
9344848 1997 Cloning and characterization of novel CIS family genes.
9266833 1997 Cloning and functional analysis of new members of STAT induced STAT inhibitor (SSI) family: SSI-2 and SSI-3.
9202403 1997 The last proline of Box 1 is essential for association with JAK2 and functional activation of the prolactin receptor.