Property Summary

NCBI Gene PubMed Count 322
PubMed Score 1163.75
PubTator Score 792.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple Sclerosis 1.100 4.5e-02
active Crohn's disease 2.537 3.1e-02
active ulcerative colitis 1.708 6.0e-03
Atopic dermatitis 1.100 2.6e-04
atypical teratoid / rhabdoid tumor 1.200 1.3e-02
cutaneous lupus erythematosus 2.000 3.9e-03
nasopharyngeal carcinoma 1.600 3.4e-04
osteosarcoma 1.149 2.2e-02
pituitary cancer -2.600 7.1e-05
tuberculosis -1.600 1.5e-04

Protein-protein Interaction (2)

Gene RIF (292)

AA Sequence

MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA      1 - 70
SALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGS     71 - 140
RESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQ    141 - 210
I//

Text Mined References (324)

PMID Year Title