Property Summary

NCBI Gene PubMed Count 6
PubMed Score 64.75
PubTator Score 38.90

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (28)

Disease log2 FC p
chronic lymphocytic leukemia 1.801 7.6e-03
astrocytic glioma -1.500 6.2e-03
ependymoma -1.800 2.4e-05
oligodendroglioma -1.100 8.7e-03
psoriasis -1.200 3.1e-07
osteosarcoma 1.176 2.8e-02
glioblastoma -2.900 7.8e-05
cystic fibrosis 1.616 8.7e-06
atypical teratoid / rhabdoid tumor -3.700 1.5e-05
medulloblastoma -1.600 1.7e-03
medulloblastoma, large-cell -3.800 1.0e-06
primitive neuroectodermal tumor -1.800 2.2e-02
non-small cell lung cancer -1.314 5.3e-11
intraductal papillary-mucinous carcinoma... -1.900 3.4e-02
intraductal papillary-mucinous neoplasm ... -1.600 4.7e-02
lung cancer 1.300 2.5e-02
adult high grade glioma -2.500 5.2e-05
pilocytic astrocytoma -1.100 1.9e-02
invasive ductal carcinoma -2.300 2.0e-02
lung adenocarcinoma -1.338 1.5e-03
Breast cancer -1.700 2.3e-08
lung carcinoma 2.000 1.0e-41
breast carcinoma -1.400 8.1e-30
mucosa-associated lymphoid tissue lympho... 1.041 4.2e-02
ductal carcinoma in situ -1.600 1.1e-03
ovarian cancer -3.600 2.6e-10
chronic rhinosinusitis -1.263 9.1e-03
dermatomyositis 1.100 1.4e-02

Gene RIF (2)

PMID Text
21035105 This study shows mutated SOBP involvement in syndromic and nonsyndromic ID with psychosis in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAEMEKEGRPPENKRSRKPAHPVKREINEEMKNFAENTMNELLGWYGYDKVELKDGEDIEFRSYPTDGES      1 - 70
RQHISVLKENSLPKPKLPEDSVISPYNISTGYSGLATGNGLSDSPAGSKDHGSVPIIVPLIPPPFIKPPA     71 - 140
EDDVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFAACRRAYFKRNKARDEDGHAENFPQQHYAKE    141 - 210
TPRLAFKNNCELLVCDWCKHIRHTKEYLDFGDGERRLQFCSAKCLNQYKMDIFYKETQANLPAGLCSTLH    211 - 280
PPMENKAEGTGVQLLTPDSWNIPLTDARRKAPSPVATAGQSQGPGPSASTTVSPSDTANCSVTKIPTPVP    281 - 350
KSIPISETPNIPPVSVQPPASIGPPLGVPPRSPPMVMTNRGPVPLPIFMEQQIMQQIRPPFIRGPPHHAS    351 - 420
NPNSPLSNPMLPGIGPPPGGPRNLGPTSSPMHRPMLSPHIHPPSTPTMPGNPPGLLPPPPPGAPLPSLPF    421 - 490
PPVSMMPNGPMPVPQMMNFGLPSLAPLVPPPTLLVPYPVIVPLPVPIPIPIPIPHVSDSKPPNGFSSNGE    491 - 560
NFIPNAPGDSAAAGGKPSGHSLSPRDSKQGSSKSADSPPGCSGQALSLAPTPAEHGRSEVVDLTRRAGSP    561 - 630
PGPPGAGGQLGFPGVLQGPQDGVIDLTVGHRARLHNVIHRALHAHVKAEREPSAAERRTCGGCRDGHCSP    631 - 700
PAAGDPGPGAPAGPEAAAACNVIVNGTRGAAAEGAKSAEPPPEQPPPPPPPAPPKKLLSPEEPAVSELES    701 - 770
VKENNCASNCHLDGEAAKKLMGEEALAGGDKSDPNLNNPADEDHAYALRMLPKTGCVIQPVPKPAEKAAM    771 - 840
APCIISSPMLSAGPEDLEPPLKRRCLRIRNQNK                                         841 - 873
//

Text Mined References (8)

PMID Year Title
23086935 2012 Poly-small ubiquitin-like modifier (PolySUMO)-binding proteins identified through a string search.
21035105 2010 SOBP is mutated in syndromic and nonsyndromic intellectual disability and is highly expressed in the brain limbic system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.