Property Summary

NCBI Gene PubMed Count 6
PubMed Score 74.00
PubTator Score 38.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma -1.600 5.0e-04
astrocytic glioma -1.500 6.2e-03
Astrocytoma, Pilocytic -1.100 2.1e-02
atypical teratoid / rhabdoid tumor -3.700 1.5e-05
Breast cancer -1.700 2.3e-08
breast carcinoma -1.400 8.1e-30
Chronic Lymphocytic Leukemia 1.801 7.6e-03
chronic rhinosinusitis -1.263 9.1e-03
cystic fibrosis 1.616 8.7e-06
dermatomyositis 1.100 1.4e-02
ductal carcinoma in situ -1.600 1.1e-03
ependymoma -1.400 1.0e-02
glioblastoma -1.400 7.7e-05
group 4 medulloblastoma -1.100 3.1e-02
intraductal papillary-mucinous carcinoma... -1.900 3.4e-02
intraductal papillary-mucinous neoplasm ... -1.600 4.7e-02
invasive ductal carcinoma -1.566 1.6e-03
lung adenocarcinoma -1.338 1.5e-03
lung cancer 1.300 2.5e-02
lung carcinoma 2.000 1.0e-41
medulloblastoma, large-cell -3.400 3.7e-06
mucosa-associated lymphoid tissue lympho... 1.041 4.2e-02
non-small cell lung cancer -1.314 5.3e-11
oligodendroglioma -1.100 8.7e-03
osteosarcoma 1.176 2.8e-02
ovarian cancer -3.600 2.6e-10
primitive neuroectodermal tumor -1.500 2.5e-02
psoriasis -1.200 3.1e-07

Gene RIF (2)

AA Sequence

MAEMEKEGRPPENKRSRKPAHPVKREINEEMKNFAENTMNELLGWYGYDKVELKDGEDIEFRSYPTDGES      1 - 70
RQHISVLKENSLPKPKLPEDSVISPYNISTGYSGLATGNGLSDSPAGSKDHGSVPIIVPLIPPPFIKPPA     71 - 140
EDDVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFAACRRAYFKRNKARDEDGHAENFPQQHYAKE    141 - 210
TPRLAFKNNCELLVCDWCKHIRHTKEYLDFGDGERRLQFCSAKCLNQYKMDIFYKETQANLPAGLCSTLH    211 - 280
PPMENKAEGTGVQLLTPDSWNIPLTDARRKAPSPVATAGQSQGPGPSASTTVSPSDTANCSVTKIPTPVP    281 - 350
KSIPISETPNIPPVSVQPPASIGPPLGVPPRSPPMVMTNRGPVPLPIFMEQQIMQQIRPPFIRGPPHHAS    351 - 420
NPNSPLSNPMLPGIGPPPGGPRNLGPTSSPMHRPMLSPHIHPPSTPTMPGNPPGLLPPPPPGAPLPSLPF    421 - 490
PPVSMMPNGPMPVPQMMNFGLPSLAPLVPPPTLLVPYPVIVPLPVPIPIPIPIPHVSDSKPPNGFSSNGE    491 - 560
NFIPNAPGDSAAAGGKPSGHSLSPRDSKQGSSKSADSPPGCSGQALSLAPTPAEHGRSEVVDLTRRAGSP    561 - 630
PGPPGAGGQLGFPGVLQGPQDGVIDLTVGHRARLHNVIHRALHAHVKAEREPSAAERRTCGGCRDGHCSP    631 - 700
PAAGDPGPGAPAGPEAAAACNVIVNGTRGAAAEGAKSAEPPPEQPPPPPPPAPPKKLLSPEEPAVSELES    701 - 770
VKENNCASNCHLDGEAAKKLMGEEALAGGDKSDPNLNNPADEDHAYALRMLPKTGCVIQPVPKPAEKAAM    771 - 840
APCIISSPMLSAGPEDLEPPLKRRCLRIRNQNK                                         841 - 873
//

Text Mined References (9)

PMID Year Title