Property Summary

NCBI Gene PubMed Count 33
PubMed Score 37.73
PubTator Score 27.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.400 1.9e-04
facioscapulohumeral dystrophy 2.500 3.9e-04

Gene RIF (21)

PMID Text
24478032 TG-interacting factor 1 (Tgif1) is an important repressor of SOAT2 gene expression.
24103759 CDX2, a known positive regulator of hepatocyte differentiation, was regulated by miR-181d and directly activated SOAT2 gene expression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17303779 We resequenced 4 candidate genes for HDL regulation and identified several functional nonsynonymous mutations including 4 in lecithin:cholesterol acyltransferase (LCAT), leaving 88% (110/124) of HDL deficient subjects without a genetic diagnosis.
16647063 histidine residues located at the active site are very crucial both for the catalytic activity of the enzyme and for distinguishing ACAT1 from ACAT2 with respect to enzyme catalysis and substrate specificity
16331323 Alternative splicing produces two human ACAT2 mRNA variants that encode the novel ACAT2 isoenzymes. Our findings might help to understand the regulation of the ACAT2 gene expression under certain physiological and pathological conditions.
16274362 Elevated ACAT2 expression may serve as a new biomarker for certain form(s) of hepatocellular carcinoma.
16230498 Serum-induced depletion of cellular cholesterol available for esterification by ACAT was a strong, independent predictor of major adverse cardiovascular events and death.
15992359 The structural features of various sterols as substrates and/or activators of ACAT1 and ACAT2 in vitro are reported.
15961790 transcription factors hepatic nuclear factor 1 (HNF1)alpha and beta play an important part in the regulation of the ACAT2 promoter
15451793 ACAT2 provided the major cholesterol-esterifying activity in 3 of 4 human liver samples.
15308631 increasing DGAT1, ACAT1, or ACAT2 expression stimulates the assembly and secretion of VLDL from liver cells
14729857 ACAT-1 transcripts predominate in human liver and ACAT-2 transcripts predominate in human duodenum and support the notion that ACAT-2 has an important regulatory role in liver and intestine.
14615411 Fully differentiated macrophages express ACAT2 in addition to ACAT1 under various pathologic conditions.
12621162 We found a new single-nucleotide polymorphism (SNP; a point mutation in intron 1, IVS1 -8 G-->C) in the ACAT-2 gene. Our data suggest that the ACAT-2 gene may not affect lipid levels in humans.

AA Sequence

MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQLRELLDRAMRE      1 - 70
AIQSYPSQDKPLPPPPPGSLSRTQEPSLGKQKVFIIRKSLLDELMEVQHFRTIYHMFIAGLCVFIISTLA     71 - 140
IDFIDEGRLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLAPYQALRLWARGTWTQATGLGCALLAAHAVV    141 - 210
LCALPVHVAVEHQLPPASRCVLVFEQVRFLMKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTL    211 - 280
IYRETYPRTPYVRWNYVAKNFAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFM    281 - 350
LLLIFFAFLHCWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG    351 - 420
VAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTMLFLGQGIQVS    421 - 490
LYCQEWYARRHCPLPQATFWGLVTPRSWSCHT                                          491 - 522
//

Text Mined References (35)

PMID Year Title
24478032 2014 TG-interacting factor 1 acts as a transcriptional repressor of sterol O-acyltransferase 2.
24103759 2013 Thyroid hormone negatively regulates CDX2 and SOAT2 mRNA expression via induction of miRNA-181d in hepatic cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
17303779 2007 Genetic etiology of isolated low HDL syndrome: incidence and heterogeneity of efflux defects.
16647063 2006 A critical role for the histidine residues in the catalytic function of acyl-CoA:cholesterol acyltransferase catalysis: evidence for catalytic difference between ACAT1 and ACAT2.
16541075 2006 The finished DNA sequence of human chromosome 12.
16331323 2005 Two human ACAT2 mRNA variants produced by alternative splicing and coding for novel isoenzymes.
16274362 2006 Human acyl-CoA:cholesterol acyltransferase 2 gene expression in intestinal Caco-2 cells and in hepatocellular carcinoma.
16230498 2005 Ability of serum to decrease cellular acylCoA:cholesterol acyl transferase activity predicts cardiovascular outcomes.
15992359 2005 Investigating the allosterism of acyl-CoA:cholesterol acyltransferase (ACAT) by using various sterols: in vitro and intact cell studies.
15961790 2005 Control of ACAT2 liver expression by HNF1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451793 2004 ACAT2 is localized to hepatocytes and is the major cholesterol-esterifying enzyme in human liver.
15308631 2004 Overexpression of human diacylglycerol acyltransferase 1, acyl-coa:cholesterol acyltransferase 1, or acyl-CoA:cholesterol acyltransferase 2 stimulates secretion of apolipoprotein B-containing lipoproteins in McA-RH7777 cells.
14729857 2004 Quantitative analysis of the expression of ACAT genes in human tissues by real-time PCR.
14615411 2003 Acyl-coenzyme A:cholesterol acyltransferase 2 (ACAT2) is induced in monocyte-derived macrophages: in vivo and in vitro studies.
12808042 2003 Human acyl-coenzyme A:cholesterol acyltransferase expressed in chinese hamster ovary cells: membrane topology and active site location.
12621162 2003 Effects of a new single-nucleotide polymorphism in the Acyl-CoA:cholesterol acyltransferase-2 gene on plasma lipids and apolipoproteins in patients with hyperlipidemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401500 2001 Organization of human ACAT-2 gene and its cell-type-specific promoter activity.
11325614 2001 Structure of the human acyl-CoA:cholesterol acyltransferase-2 (ACAT-2) gene and its relation to dyslipidemia.
11294643 2001 Differential modulation of ACAT1 and ACAT2 transcription and activity by long chain free fatty acids in cultured cells.
11071899 2000 ACAT1 and ACAT2 membrane topology segregates a serine residue essential for activity to opposite sides of the endoplasmic reticulum membrane.
11042153 2000 High-resolution transcript map of the region spanning D12S1629 and D12S312 at chromosome 12q13: triple A syndrome-linked region.
10846185 2000 Immunological quantitation and localization of ACAT-1 and ACAT-2 in human liver and small intestine.
9756920 1998 Characterization of two human genes encoding acyl coenzyme A:cholesterol acyltransferase-related enzymes.
9756919 1998 ACAT-2, a second mammalian acyl-CoA:cholesterol acyltransferase. Its cloning, expression, and characterization.
9242919 1997 Acyl-coenzyme A:cholesterol acyltransferase.
8650549 1996 Sterol esterification in yeast: a two-gene process.