Property Summary

NCBI Gene PubMed Count 44
PubMed Score 95.20
PubTator Score 44.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.242 1.5e-02
Atopic dermatitis -1.300 1.4e-04
primary pancreatic ductal adenocarcinoma 2.417 2.4e-04
tuberculosis -2.500 4.1e-06
intraductal papillary-mucinous adenoma (... 1.100 7.9e-04
Breast cancer 2.600 4.7e-02
mucosa-associated lymphoid tissue lympho... 1.247 2.2e-02
ductal carcinoma in situ -1.100 1.6e-03
ovarian cancer 2.000 4.0e-05
pancreatic cancer 2.000 1.2e-03

Gene RIF (24)

PMID Text
26608909 reduced levels of SNX9 were observed in blood samples from colorectal cancer patients, emphasizing the feasibility of its use as a diagnostic and prognostic biomarker sensing the host's immune status and inflammatory stage.
25256216 this study shows that SNX9 uses a unique mechanism to induce the tubulation of the plasma membrane which mediates proper membrane deformation during clathrin-mediated endocytosis.
23861900 SNX9 and CHC function in the same molecular pathway for chromosome alignment and segregation, which is dependent on their direct association.
22718350 The sorting nexin 9 (SNX9) subfamily members - SNX9, SNX18 and SNX33 - are required for progression and completion of mitosis.
20964629 study identifies critical amino acids within the BAR domains of SNX9 and SNX33 as determinants for the specificity of BAR domain-mediated interactions and suggests that SNX9 and SNX33 have distinct molecular functions.
20491914 The interaction with SNX9 is mediated by the proline-rich domain (PRD) of Itch, a domain distinct from the conventional WW recognition domain, and the SH3 domain of SNX9.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20129922 SNX9 binding to aldolase is structurally precluded by the binding of substrate to the active site.
20088948 Findings suggest that EspF promotes EPEC invasion of intestinal epithelial cells by harnessing the membrane-deforming activity of SNX9.
18940612 Tip-to-tip interactions between the BAR domains in a trigonal crystal form of Snx9(PX-BAR) reminiscent of functionally important interactions described for F-BAR domains.
18682798 Observational study of gene-disease association. (HuGE Navigator)
18388313 SNX9 functions in the coordination of membrane remodeling and fission via interactions with actin-regulating proteins, endocytic proteins and PtdIns(4,5)P2-metabolizing enzymes
18065239 crystallization and x-ray diffraction of SNX9
17948057 SNX9 PX and BAR domains work in concert in targeting and tubulation of phosphoinositide-containing membranes.
17609109 SNX9 is directly involved in coupling actin dynamics to achieve membrane remodeling during multiple modes of endocytosis
17242350 the WASp/SNX9/p85/CD28 complex enables a unique interface of endocytic, actin polymerizing, and signal transduction pathways required for CD28-mediated T cell costimulation
16585770 identified sorting nexin 9 (SNX9) as a host cell enteropathogenic E. coli EspF binding partner protein, which binds EspF via its amino-terminal SH3 region
16316319 Dimerization, which is mediated by the BAR domain, is essential for the intracellular function of SH3PX1.
16137687 Data show that in the presence of SNX9, synaptojanin-1 is able to colocalize with distinct ACK1 containing vesicles.
15703209 SNX9 is required for efficient clathrin-mediated endocytosis and suggest that it functions to regulate dynamin activity
15299020 SNX9-dependent recruitment of Dyn2 to the membrane is regulated by an interaction between SNX9 and aldolase
12952949 SNX9 may be recruited together with dynamin-2 and become co-assembled with AP-2 and clathrin at the plasma membrane
11879186 SNX9 may function to assist AP-2 in its role at the plasma membrane.
11799118 The Cdc42 target ACK2 interacts with sorting nexin 9 (SH3PX1) to regulate epidermal growth factor receptor degradation

AA Sequence

MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSC      1 - 70
GNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNT     71 - 140
PNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPG    141 - 210
FAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTN    211 - 280
RSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVF    281 - 350
QQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVG    351 - 420
QEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLM    421 - 490
ECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRI    491 - 560
YDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM                                       561 - 595
//

Text Mined References (49)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26608909 2016 Impaired SNX9 Expression in Immune Cells during Chronic Inflammation: Prognostic and Diagnostic Implications.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25256216 2014 The unique mechanism of SNX9 BAR domain for inducing membrane tubulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23861900 2013 Sorting nexin 9 recruits clathrin heavy chain to the mitotic spindle for chromosome alignment and segregation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22718350 2012 SNX9, SNX18 and SNX33 are required for progression through and completion of mitosis.
21269460 2011 Initial characterization of the human central proteome.
21048941 2010 The SNX-PX-BAR family in macropinocytosis: the regulation of macropinosome formation by SNX-PX-BAR proteins.
20964629 2011 Specific amino acids in the BAR domain allow homodimerization and prevent heterodimerization of sorting nexin 33.
20491914 2010 The E3 ubiquitin ligase Itch regulates sorting nexin 9 through an unconventional substrate recognition domain.
20427313 2010 SNX18 shares a redundant role with SNX9 and modulates endocytic trafficking at the plasma membrane.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20129922 2010 Mechanism of aldolase control of sorting nexin 9 function in endocytosis.
20088948 2010 E. coli secreted protein F promotes EPEC invasion of intestinal epithelial cells via an SNX9-dependent mechanism.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19487689 2009 Sorting nexin 33 induces mammalian cell micronucleated phenotype and actin polymerization by interacting with Wiskott-Aldrich syndrome protein.
19092055 2009 SNX9 - a prelude to vesicle release.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18940612 2008 Structure and plasticity of Endophilin and Sorting Nexin 9.
18682798 2008 Genes to diseases (G2D) computational method to identify asthma candidate genes.
18388313 2008 SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.
18353773 2008 A novel sorting nexin modulates endocytic trafficking and alpha-secretase cleavage of the amyloid precursor protein.
18065239 2008 A combinatorial approach to crystallization of PX-BAR unit of the human Sorting Nexin 9.
17948057 2007 The PX-BAR membrane-remodeling unit of sorting nexin 9.
17609109 2007 SNX9 couples actin assembly to phosphoinositide signals and is required for membrane remodeling during endocytosis.
17242350 2007 Interaction of the Wiskott-Aldrich syndrome protein with sorting nexin 9 is required for CD28 endocytosis and cosignaling in T cells.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
16585770 2006 EspF of enteropathogenic Escherichia coli binds sorting nexin 9.
16374509 2006 Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16316319 2006 Dimerization is required for SH3PX1 tyrosine phosphorylation in response to epidermal growth factor signalling and interaction with ACK2.
16137687 2005 SNX9 as an adaptor for linking synaptojanin-1 to the Cdc42 effector ACK1.
15703209 2005 SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15299020 2004 Regulated membrane recruitment of dynamin-2 mediated by sorting nexin 9.
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14679214 2004 A novel proteomic screen for peptide-protein interactions.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12952949 2003 Sorting nexin 9 participates in clathrin-mediated endocytosis through interactions with the core components.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11879186 2002 The beta-appendages of the four adaptor-protein (AP) complexes: structure and binding properties, and identification of sorting nexin 9 as an accessory protein to AP-2.
11799118 2002 The Cdc42 target ACK2 interacts with sorting nexin 9 (SH3PX1) to regulate epidermal growth factor receptor degradation.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.
10531379 1999 Interaction of the metalloprotease disintegrins MDC9 and MDC15 with two SH3 domain-containing proteins, endophilin I and SH3PX1.