Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.14
PubTator Score 3.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.500 3.4e-08
psoriasis 1.200 5.1e-03
osteosarcoma 2.076 3.0e-04
glioblastoma 1.500 8.3e-05
medulloblastoma, large-cell -2.400 1.5e-03
Duchenne muscular dystrophy 1.614 1.9e-08
limb girdle muscular dystrophy 2A 1.401 7.2e-05
autosomal dominant Emery-Dreifuss muscul... 2.019 2.5e-03
Becker muscular dystrophy 1.192 4.1e-04
Amyotrophic Lateral Sclerosis 1.552 1.0e-06
lung cancer 1.500 1.9e-02
interstitial cystitis -1.200 3.2e-04
group 4 medulloblastoma -2.400 4.0e-05
ovarian cancer 2.700 3.1e-04

AA Sequence

MDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIITKTSRGEFDSSEFEV      1 - 70
RRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDF     71 - 140
KIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRI    141 - 210
YKEEREYFDEMKEYGPIHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEM    211 - 280
LMGVMKRRDQIQAELDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFT    281 - 350
DMAEENIHYYEQCLATWESFLTSQTNLHLEEASEDKP                                     351 - 387
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
20203127 2010 Do GnRH analogues directly affect human endometrial epithelial cell gene expression?
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16130112 2005 New locus for hereditary spastic paraplegia maps to chromosome 1p31.1-1p21.1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.