Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.24
PubTator Score 9.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.642 6.0e-05
juvenile dermatomyositis 1.217 2.3e-09
acute quadriplegic myopathy 1.016 6.2e-05
primary pancreatic ductal adenocarcinoma 1.454 1.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.0e-02
ovarian cancer -1.300 6.7e-05
pancreatic cancer 1.100 1.9e-02

Gene RIF (6)

PMID Text
25535984 These results identify SNX6 as a key regulator of lamin A synthesis and incorporation into the nuclear envelope.
25496667 Genome-wide shRNA screening identifies SNX6, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20830743 Study observed that SNX6 increases BRMS1-dependent transcriptional repression. Moreover, over-expression of SNX6 was capable of diminishing trans-activation in a dose-dependent manner.
20354142 SNX6 modulates the retrograde trafficking and basal levels of BACE1, thereby regulating BACE1-mediated APP processing and Abeta biogenesis
19935774 These observations indicate that in addition to SNX1/2, SNX6 in association with the dynein/dynactin complex drives the formation and movement of tubular retrograde intermediates.
17148574 SNX5 and SNX6 may constitute functional equivalents of Vps17p in mammalian retromer

AA Sequence

MMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQH      1 - 70
EEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKT     71 - 140
VAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFF    141 - 210
EHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKI    211 - 280
EARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQK    281 - 350
FEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT                  351 - 406
//

Text Mined References (30)

PMID Year Title
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
26172538 2015 Retromer Ensures the Degradation of Autophagic Cargo by Maintaining Lysosome Function in Drosophila.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25535984 2014 Sorting nexin 6 enhances lamin a synthesis and incorporation into the nuclear envelope.
24610942 2014 Isoform 5 of PIPKI? regulates the endosomal trafficking and degradation of E-cadherin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20830743 2010 Sorting nexin 6 interacts with breast cancer metastasis suppressor-1 and promotes transcriptional repression.
20354142 2010 Proteomic identification of sorting nexin 6 as a negative regulator of BACE1-mediated APP processing.
19935774 2009 The retromer component SNX6 interacts with dynactin p150(Glued) and mediates endosome-to-TGN transport.
19619496 2009 The retromer coat complex coordinates endosomal sorting and dynein-mediated transport, with carrier recognition by the trans-Golgi network.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18253931 2008 Vesicle associated membrane protein (VAMP)-7 and VAMP-8, but not VAMP-2 or VAMP-3, are required for activation-induced degranulation of mature human mast cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17148574 2007 A loss-of-function screen reveals SNX5 and SNX6 as potential components of the mammalian retromer.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591366 2001 Pim-1 translocates sorting nexin 6/TRAF4-associated factor 2 from cytoplasm to nucleus.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11278302 2001 Transforming growth factor-beta receptor-associated protein 1 is a Smad4 chaperone.