Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.87
PubTator Score 9.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.016 6.2e-05
intraductal papillary-mucinous neoplasm ... 1.200 1.0e-02
juvenile dermatomyositis 1.217 2.3e-09
osteosarcoma 1.642 6.0e-05
ovarian cancer -1.300 6.7e-05
pancreatic cancer 1.100 1.9e-02
primary pancreatic ductal adenocarcinoma 1.454 1.6e-03

Gene RIF (6)

AA Sequence

MMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQH      1 - 70
EEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKT     71 - 140
VAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFF    141 - 210
EHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKI    211 - 280
EARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQK    281 - 350
FEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT                  351 - 406
//

Text Mined References (33)

PMID Year Title