Tbio | Sorting nexin-5 |
Involved in several stages of intracellular trafficking. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)) or phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) (PubMed:15561769). Acts in part as component of the retromer membrane-deforming SNX-BAR subcomplex. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX-BAR subcomplex functions to deform the donor membrane into a tubular profile called endosome-to-TGN transport carrier (ETC) (Probable). Does not have in vitro vesicle-to-membrane remodeling activity (PubMed:23085988). Involved in retrograde transport of lysosomal enzyme receptor IGF2R (PubMed:17148574, PubMed:18596235). May function as link between endosomal transport vesicles and dynactin (Probable). Plays a role in the internalization of EGFR after EGF stimulation (Probable). Involved in EGFR endosomal sorting and degradation; the function involves PIP5K1C isoform 3 and is retromer-independent (PubMed:23602387). Together with PIP5K1C isoform 3 facilitates HGS interaction with ubiquitinated EGFR, which initiates EGFR sorting to intraluminal vesicles (ILVs) of the multivesicular body for subsequent lysosomal degradation (Probable). Involved in E-cadherin sorting and degradation; inhibits PIP5K1C isoform 3-mediated E-cadherin degradation (PubMed:24610942). Plays a role in macropinocytosis (PubMed:18854019, PubMed:21048941).
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Disease Progression | 136 | 0.0 | 0.0 |
Stomach Neoplasms | 300 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2890 | 1.3e-14 |
ependymoma | 4679 | 2.4e-12 |
pediatric high grade glioma | 1064 | 2.2e-06 |
cystic fibrosis | 1696 | 6.4e-06 |
ovarian cancer | 8520 | 9.2e-05 |
atypical teratoid / rhabdoid tumor | 5112 | 1.3e-04 |
medulloblastoma, large-cell | 6241 | 4.6e-04 |
medulloblastoma | 720 | 4.9e-04 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 6.4e-04 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 2.0e-03 |
invasive ductal carcinoma | 2951 | 8.1e-03 |
primary Sjogren syndrome | 735 | 1.9e-02 |
Breast cancer | 3578 | 2.7e-02 |
pancreatic ductal adenocarcinoma liver metastasis | 1962 | 3.1e-02 |
gastric carcinoma | 807 | 4.6e-02 |
Disease | log2 FC | p |
---|---|---|
atypical teratoid / rhabdoid tumor | 1.100 | 1.3e-04 |
Breast cancer | 2.600 | 2.7e-02 |
cystic fibrosis | -1.511 | 6.4e-06 |
ependymoma | 1.200 | 2.4e-12 |
gastric carcinoma | 1.200 | 4.6e-02 |
intraductal papillary-mucinous carcinoma... | 1.400 | 2.0e-03 |
intraductal papillary-mucinous neoplasm ... | 1.400 | 6.4e-04 |
invasive ductal carcinoma | 1.100 | 8.1e-03 |
medulloblastoma | 1.100 | 4.9e-04 |
medulloblastoma, large-cell | 1.400 | 4.6e-04 |
non-small cell lung cancer | 1.372 | 1.3e-14 |
ovarian cancer | 2.300 | 9.2e-05 |
pancreatic ductal adenocarcinoma liver m... | -1.479 | 3.1e-02 |
pediatric high grade glioma | 1.100 | 2.2e-06 |
primary Sjogren syndrome | 1.100 | 1.9e-02 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG |
MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHE 1 - 70 DFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTV 71 - 140 SSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE 141 - 210 QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVE 211 - 280 GRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKF 281 - 350 EQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN 351 - 404 //