Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.94
PubTator Score 5.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 7.3e-17
ovarian cancer 8520 1.9e-10
medulloblastoma, large-cell 6241 5.0e-05
invasive ductal carcinoma 2951 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
invasive ductal carcinoma -1.100 1.4e-03
lung carcinoma -1.100 7.3e-17
medulloblastoma, large-cell -1.200 5.0e-05
ovarian cancer -1.500 1.9e-10

Gene RIF (6)

AA Sequence

MALKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIVRSGISTNHADY      1 - 70
SSSPAGSPGAQVSLYNSPSVASPARSGGGSGFLSNQGSFEEDDDDDWDDWDDGCTVVEEPRAGGLGTNGH     71 - 140
PPLNLSYPGAYPSQHMAFRPKPPLERQDSLASAKRGSVVGRNLNRFSCFVRSGVEAFILGDVPMMAKIAE    141 - 210
TYSIEMGPRGPQWKANPHPFACSVEDPTKQTKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHK    211 - 280
FTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEK    281 - 350
DEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSA    351 - 420
FQAISHSFQMDPPFCSEALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQK    421 - 490
GAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRV    491 - 560
GQQLEKTLRMYDNL                                                            561 - 574
//

Text Mined References (20)

PMID Year Title