Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.55
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
tuberculosis and treatment for 3 months 327 6.0e-07
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Disease Target Count Z-score Confidence
Testicular lymphoma 2 3.02 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis and treatment for 3 months 1.600 6.0e-07

Synonym

Accession Q8TEQ0 B5MDW2 Q8N2X2 Q9HA26
Symbols RUNDC2A
A-388D4.1

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
25496667 Genome-wide shRNA screening identifies SNX29, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23358160 The strongest associated SNP in the combined analysis, including Danish and German-Dutch samples, was rs12922317 in RUNDC2A.
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKRSRGLALTAAAI      1 - 70
KQAAGFASKTETEPVFWYYVKEVLNKHELQRFYSLRHIASDVGRGRAWLRCALNEHSLERYLHMLLADRC     71 - 140
RLSTFYEDWSFVMDEERSSMLPTMAAGLNSILFAINIDNKDLNGQSKFAPTVSDLLKESTQNVTSLLKES    141 - 210
TQGVSSLFREITASSAVSILIKPEQETDPLPVVSRNVSADAKCKKERKKKKKVTNIISFDDEEDEQNSGD    211 - 280
VFKKTPGAGESSEDNSDRSSVNIMSAFESPFGPNSNGSQSSNSWKIDSLSLNGEFGYQKLDVKSIDDEDV    281 - 350
DENEDDVYGNSSGRKHRGHSESPEKPLEGNTCLSQMHSWAPLKVLHNDSDILFPVSGVGSYSPADAPLGS    351 - 420
LENGTGPEDHVLPDPGLRYSVEASSPGHGSPLSSLLPSASVPESMTISELRQATVAMMNRKDELEEENRS    421 - 490
LRNLLDGEMEHSAALRQEVDTLKRKVAEQEERQGMKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEV    491 - 560
PNLWSVDGEVTVAEQKPGEIAEELASSYERKLIEVAEMHGELIEFNERLHRALVAKEALVSQMRQELIDL    561 - 630
RGPVPGDLSQTSEDQSLSDFEISNRALINVWIPSVFLRGKAANAFHVYQVYIRIKDDEWNIYRRYTEFRS    631 - 700
LHHKLQNKYPQVRAYNFPPKKAIGNKDAKFVEERRKQLQNYLRSVMNKVIQMVPEFAASPKKETLIQLMP    701 - 770
FFVDITPPGEPVNSRPKAASRFPKLSRGQPRETRNVEPQSGDL                               771 - 813
//

Text Mined References (20)

PMID Year Title
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23358160 2014 Genome-wide study of association and interaction with maternal cytomegalovirus infection suggests new schizophrenia loci.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16782399 2006 The Phox (PX) domain proteins and membrane traffic.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.