Property Summary

NCBI Gene PubMed Count 37
PubMed Score 38.27
PubTator Score 34.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma -1.500 1.3e-03
lung cancer 1.500 4.3e-04
medulloblastoma, large-cell -1.100 2.1e-05
osteosarcoma 2.856 5.3e-09
Pick disease 1.100 3.5e-04
posterior fossa group B ependymoma -1.500 1.9e-06
psoriasis -1.200 5.2e-10
Rheumatoid arthritis 1.100 2.4e-03

Gene RIF (27)

AA Sequence

MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSI      1 - 70
NGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEA     71 - 140
DNLDPSDDSLGQSFYDYTEKQAVPISVPRYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKRE    141 - 210
FANFTFPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVA    211 - 280
LPDGTTVTVRVKKNSTTDQVYQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAV    281 - 350
PGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRT    351 - 420
CEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEY    421 - 490
ARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQMARSQQRDVAT                       491 - 541
//

Text Mined References (43)

PMID Year Title