Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.15
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.765 2.4e-03
adrenocortical carcinoma -1.232 5.9e-05
breast carcinoma -1.300 1.7e-04
fibroadenoma -1.200 2.8e-02
group 3 medulloblastoma -2.000 1.4e-03
subependymal giant cell astrocytoma 1.579 1.3e-02
spina bifida -1.116 4.2e-02
ductal carcinoma in situ -1.200 7.8e-03
invasive ductal carcinoma -2.100 4.9e-04
ovarian cancer -1.400 5.4e-10

 GO Process (1)

Gene RIF (1)

PMID Text
12459172 Data suggest that human sorting nexin-L (SNX-L) may be a regulatory gene involved in receptor protein degradation during embryonic liver development.

AA Sequence

MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDE      1 - 70
DDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANV     71 - 140
VKDPPSKYVLYTLAVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPRKRLRRNFTAETIA    141 - 210
RRSRAFEQFLGHLQAVPELRHAPDLQDFFVLPELRRAQSLTCTGLYREALALWANAWQLQAQLGTPSGPD    211 - 280
RPLLTLAGLAVCHQELEDPGEARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEARLQAL    281 - 350
QEAGLTPTPPPSLKELLIKEVLD                                                   351 - 373
//

Text Mined References (10)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.
12459172 2002 Expression of a novel member of sorting nexin gene family, SNX-L, in human liver development.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11736640 2001 The Phox homology (PX) domain, a new player in phosphoinositide signalling.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.