Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.90
PubTator Score 1.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.400 4.6e-02
osteosarcoma -4.479 2.6e-06
glioblastoma 1.100 1.4e-02
interstitial cystitis 2.200 1.0e-03
adult high grade glioma 1.400 5.8e-04
pilocytic astrocytoma 1.100 3.8e-06
primary Sjogren syndrome 2.000 1.8e-03
subependymal giant cell astrocytoma 1.588 6.1e-03
psoriasis 1.300 7.3e-11
invasive ductal carcinoma 1.100 1.9e-02
ulcerative colitis 1.700 4.9e-05
head and neck cancer and chronic obstruc... 1.200 2.8e-03

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18196517 Serves as a sorting molecule that cycles P-selectin ligand protein into endosomes with no impact on leukocyte recruitment.

AA Sequence

MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCR      1 - 70
WKHVKLLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLKTFREEIEDVEF     71 - 140
PRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREFLDFLTRPELREAFGCLRAGQYPRALELLLR    141 - 210
VLPLQEKLTAHCPAAAVPALCAVLLCHRDLDRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYAL    211 - 280
GKDFVTLQERLEESQLRRPTPRGITLKELTVREYLH                                      281 - 316
//

Text Mined References (13)

PMID Year Title
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25416956 2014 A proteome-scale map of the human interactome network.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20018961 2009 Genomewide association study of leprosy.
18196517 2008 SLIC-1/sorting nexin 20: a novel sorting nexin that directs subcellular distribution of PSGL-1.
16782399 2006 The Phox (PX) domain proteins and membrane traffic.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8586417 1995 Monitoring cell physiology by expression profiles and discovering cell type-specific genes by compiled expression profiles.
7835887 1994 Chromosomal assignments of 3'-directed partial cDNA sequences representing novel genes expressed in granulocytoid cells.