Property Summary

NCBI Gene PubMed Count 34
PubMed Score 15.20
PubTator Score 22.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.257 3.4e-03
chronic lymphocytic leukemia -1.837 5.8e-03
Multiple myeloma 1.027 7.8e-03
glioblastoma 1.900 3.9e-04
pancreatic ductal adenocarcinoma liver m... -1.467 2.1e-02
diabetes mellitus -1.100 1.1e-03
ovarian cancer -1.800 1.2e-05
Down syndrome 1.100 1.6e-03

Gene RIF (8)

PMID Text
23531855 SNX2 is highly expressed in 73.3% Graves disease patients and in 93.8% thyroid nodule patients.
23360489 Silencing of SNX2 markedly alters sensitivity to anticancer drugs targeted to c-Met.
20604901 SNX1 and SNX2 interact with the Rac1 and RhoG guanine nucleotide exchange factor Kalirin-7. Overexpression of SNX1 or SNX2 and Kalirin-7 partially redistributes both SNXs to the plasma membrane, and results in RhoG-dependent lamellipodia formation.
17319803 study indicates that hVps34 and its product PI(3)P are involved in endosome to Golgi transport of ricin, and that SNX2 and SNX4 are likely to be effectors in this pathway
17101778 These observations indicate that the mammalian retromer complex assembles by sequential association of SNX1/2 and Vps26-Vps29-Vps35 subcomplexes on endosomal membranes and that SNX1 and SNX2 play interchangeable but essential roles.
16179610 Data suggest that sorting nexin-2 is not essential for the regulation of endosome-to-trans Golgi network retrieval of the cation-independent mannose 6-phosphate receptor.
15690390 The N-terminal domain of Abs interacts with the phox homology (PX) domain of SNX2 suggesting that PX domains may also participate in protein-protein interaction
14978220 Examined the effect of a PX domain-mutated SNX2 that is defective in vesicle localization on EGFR trafficking.

AA Sequence

MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAEDISANSNGPKPTEVVLDDDR      1 - 70
EDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIF     71 - 140
DIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPE    141 - 210
KSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAG    211 - 280
ILRMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAM    281 - 350
LGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA    351 - 420
QITLLKKREAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVI    421 - 490
IKYLESLVQTQQQLIKYWEAFLPEAKAIA                                             491 - 519
//

Text Mined References (47)

PMID Year Title
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23531855 2014 Sorting Nexin 2 (SNX2): a potential marker of active thyrocytes in normal and hyperfunctioning thyroid disorders.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23360489 2013 Sorting nexin 2-mediated membrane trafficking of c-Met contributes to sensitivity of molecular-targeted drugs.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21391972 2011 Identification of FOXP1 and SNX2 as novel ABL1 fusion partners in acute lymphoblastic leukaemia.
21269460 2011 Initial characterization of the human central proteome.
20604901 2010 A novel, retromer-independent role for sorting nexins 1 and 2 in RhoG-dependent membrane remodeling.
20138391 2010 Identification of different itineraries and retromer components for endosome-to-Golgi transport of TGN38 and Shiga toxin.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19935774 2009 The retromer component SNX6 interacts with dynactin p150(Glued) and mediates endosome-to-TGN transport.
19816406 2009 Amphipathic motifs in BAR domains are essential for membrane curvature sensing.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19619496 2009 The retromer coat complex coordinates endosomal sorting and dynein-mediated transport, with carrier recognition by the trans-Golgi network.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18472259 2008 Retromer.
18088323 2008 SNX1 defines an early endosomal recycling exit for sortilin and mannose 6-phosphate receptors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17891154 2007 Functional architecture of the retromer cargo-recognition complex.
17319803 2007 Phosphoinositide-regulated retrograde transport of ricin: crosstalk between hVps34 and sorting nexins.
17101778 2007 Interchangeable but essential functions of SNX1 and SNX2 in the association of retromer with endosomes and the trafficking of mannose 6-phosphate receptors.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16179610 2005 Sorting nexin-2 is associated with tubular elements of the early endosome, but is not essential for retromer-mediated endosome-to-TGN transport.
15690390 2005 Abstrakt interacts with and regulates the expression of sorting nexin-2.
15673616 2005 Determinants of the endosomal localization of sorting nexin 1.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14978220 2004 A role for sorting nexin 2 in epidermal growth factor receptor down-regulation: evidence for distinct functions of sorting nexin 1 and 2 in protein trafficking.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14596906 2003 The formin-binding protein 17, FBP17, binds via a TNKS binding motif to tankyrase, a protein involved in telomere maintenance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.
11438682 2001 The human formin-binding protein 17 (FBP17) interacts with sorting nexin, SNX2, and is an MLL-fusion partner in acute myelogeneous leukemia.
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11278302 2001 Transforming growth factor-beta receptor-associated protein 1 is a Smad4 chaperone.
11102511 2000 Human orthologs of yeast vacuolar protein sorting proteins Vps26, 29, and 35: assembly into multimeric complexes.
9819414 1998 Identification of a family of sorting nexin molecules and characterization of their association with receptors.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.