Property Summary

NCBI Gene PubMed Count 32
PubMed Score 16.62
PubTator Score 21.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Breast size 2
Disease Target Count P-value
ovarian cancer 8491 5.3e-06
Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 1.0
Cardiovascular system disease 194 0.0 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 5.3e-06

Gene RIF (10)

PMID Text
26202251 The double knockdown of SNX17 and SNX27 results in a striking reduction of papillomavirus 16 infection due to interruption of their binding to the L2 viral protein.
25825439 SNX17 plays a role in the maintenance of normal surface levels of activating receptors and integrins to permit optimum T cell activation at the immune synapse.
25059659 Data indicate that the major binding site for binding of sorting nexin 17 (SNX17) is confined to the NPXF2 motif in cytoplasmic adaptor protein Krev interaction trapped 1 (KRIT1).
24705369 Sorting nexin 17 regulates ApoER2 recycling and reelin signaling.
23115288 The authors demonstrate that SNX17 is essential for infection with all papillomavirus types analyzed, indicating an evolutionarily highly conserved virus entry mechanism.
22492727 depletion of SNX17 in HeLa cells resulted in lysosomal degradation of multiple members of the integrin family of extracellular matrix recep-tors.
18276590 SNX17 regulates amyloid precursor protein trafficking and processing in the early endosomes
16712798 SNX17 has a role in the indicated KRIT1 function in cell adhesion processes by integrin signaling
16052210 Snx 17 binds to a motif in the low-density lipoprotein (LDL) receptor-related protein (LRP) tail distinct from the endocytosis signals and promotes LRP sorting to the recycling pathway in the early endosomes.
15769472 expression level of SNX17 may regulate the lysosomal degradation, at least for P-selectin, by suppressing its entry into the inner vesicles of the multi-vesicular bodies (MVBs)

AA Sequence

MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPA      1 - 70
EVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKVLVNVLTSDQTE     71 - 140
DVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAY    141 - 210
DDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVAD    211 - 280
FPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAF    281 - 350
EYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE    351 - 420
SPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL                        421 - 470
//

Text Mined References (41)

PMID Year Title
26202251 2015 A Novel PDZ Domain Interaction Mediates the Binding between Human Papillomavirus 16 L2 and Sorting Nexin 27 and Modulates Virion Trafficking.
25825439 2015 SNX17 affects T cell activation by regulating TCR and integrin recycling.
25059659 2014 Structural determinants for binding of sorting nexin 17 (SNX17) to the cytoplasmic adaptor protein Krev interaction trapped 1 (KRIT1).
24705369 2014 Sorting nexin 17 regulates ApoER2 recycling and reelin signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115288 2013 SNX17 facilitates infection with diverse papillomavirus types.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22492727 2012 SNX17 protects integrins from degradation by sorting between lysosomal and recycling pathways.
22151726 2012 Human papillomavirus L2 facilitates viral escape from late endosomes via sorting nexin 17.
21512128 2011 Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20226821 2010 Adaptor protein sorting nexin 17 interacts with the scavenger receptor FEEL-1/stabilin-1 and modulates its expression on the cell surface.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19005208 2009 Polarized traffic of LRP1 involves AP1B and SNX17 operating on Y-dependent sorting motifs in different pathways.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18276590 2008 Adaptor protein sorting nexin 17 regulates amyloid precursor protein trafficking and processing in the early endosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16712798 2006 Sorting nexin 17, a non-self-assembling and a PtdIns(3)P high class affinity protein, interacts with the cerebral cavernous malformation related protein KRIT1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16052210 2005 Sorting nexin 17 facilitates LRP recycling in the early endosome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15769472 2005 Functions of sorting nexin 17 domains and recognition motif for P-selectin trafficking.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15121882 2004 Sorting nexin 17 accelerates internalization yet retards degradation of P-selectin.
14739284 2004 Sorting motifs in the intracellular domain of the low density lipoprotein receptor interact with a novel domain of sorting nexin-17.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12169628 2002 The PX-domain protein SNX17 interacts with members of the LDL receptor family and modulates endocytosis of the LDL receptor.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.
11237770 2001 A new member of the sorting nexin family interacts with the C-terminus of P-selectin.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.