Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.12
PubTator Score 4.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Low tension glaucoma 7 3.218 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.2e-03
cystic fibrosis 1.088 4.6e-03
medulloblastoma, large-cell -1.500 7.5e-04
oligodendroglioma -1.200 4.5e-02
ovarian cancer -1.100 1.6e-04

Gene RIF (2)

AA Sequence

MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSS      1 - 70
PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWV     71 - 140
VFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREF    141 - 210
LCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPE    211 - 280
ESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED          281 - 344
//

Text Mined References (23)

PMID Year Title