Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.64
PubTator Score 4.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma -1.200 4.5e-02
cystic fibrosis 1.177 1.2e-04
atypical teratoid / rhabdoid tumor -1.300 1.2e-03
medulloblastoma, large-cell -1.500 7.5e-04
ovarian cancer -1.100 1.6e-04

Gene RIF (2)

PMID Text
19754948 Observational study of gene-disease association. (HuGE Navigator)
12813048 SNX16 is a sorting nexin that may function in the trafficking of proteins between the early and late endosomal compartments

AA Sequence

MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSS      1 - 70
PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWV     71 - 140
VFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREF    141 - 210
LCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPE    211 - 280
ESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED          281 - 344
//

Text Mined References (21)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
19754948 2009 Evaluation of nine candidate genes in patients with normal tension glaucoma: a case control study.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15951806 2005 Endosome-to-cytosol transport of viral nucleocapsids.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12813048 2003 Evidence for a role of SNX16 in regulating traffic between the early and later endosomal compartments.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.
11736640 2001 The Phox homology (PX) domain, a new player in phosphoinositide signalling.
11485546 2001 A large family of endosome-localized proteins related to sorting nexin 1.