Property Summary

NCBI Gene PubMed Count 48
PubMed Score 41.02
PubTator Score 44.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.600 3.1e-09
osteosarcoma -1.647 2.8e-03
atypical teratoid / rhabdoid tumor 1.200 9.8e-06
glioblastoma 1.200 2.7e-05
tuberculosis and treatment for 6 months -1.100 9.8e-04
non-small cell lung cancer -1.444 1.6e-20
lung cancer -1.900 9.7e-04
diabetes mellitus -1.400 1.2e-03
pilocytic astrocytoma 1.500 2.2e-08
lung adenocarcinoma -1.040 4.0e-05
breast carcinoma -1.500 4.4e-34
Breast cancer -1.200 7.0e-09
ductal carcinoma in situ -1.500 6.9e-05
invasive ductal carcinoma -2.300 2.0e-04
ovarian cancer -3.200 1.9e-12

Gene RIF (21)

PMID Text
25653196 Results show that suppression of EGFR membrane recycling by SNX1 appears to be critical for the activation of EGFR /PI3K/AKT signaling pathway in human lung cancer cells.
24835695 miR-95 functions as an oncogene role in non-small cell lung cancer cells by directly targeting SNX1.
23152498 SNX1 has a crucial role in D(5)R trafficking and SNX1 depletion results in D(5)R dysfunction and thus may represent a novel mechanism for the pathogenesis of essential hypertension
22859339 we suggest that SNX1 is involved in the negative regulation of ligand-induced EGFR phosphorylation and mediates EGFR/pEGFR trafficking out of early endosomes
22673115 This study found that significant evidence of association with SNX1 (VEGAS p = 0.035) in patient with Alzheimer disease.
21973056 SNX4, but not SNX1 and SNX8, is associated with the Rab11-recycling endosomes and that a high frequency of SNX4-mediated tubule formation is observed as endosomes undergo Rab4-to-Rab11 transition.
21427358 Results demonstrate that miR-95 increases proliferation by directly targeting SNX1, defining miR-95 as a new oncogenic miRNA in CRC.
20604901 SNX1 and SNX2 interact with Kalirin-7. Overexpression of SNX1 or SNX2 and Kalirin-7 partially redistributes both SNXs to the plasma membrane, and results in RhoG-dependent lamellipodia formation.
20070609 These data describe a novel function of SNX1 in the regulation of P2Y(1) receptor recycling and suggest that SNX1 plays multiple roles in endocytic trafficking of G-protein coupled receptors.
18088323 sortilin and mannose-6-phosphate receptors recycle to the TGN in SNX1-dependent carriers, which we named endosome-to-TGN transport carriers
17502486 Together, these findings demonstrate a role for SNX1 in retrieval of E-cadherin from a degradative endosomal pathway and in membrane trafficking pathways that regulate E-cadherin recycling.
17145813 The loss of SNX1 may play a significant role in the development and aggressiveness of human colon cancer, at least partially through the mechanism of increased signaling from endosomes.
17101778 These observations indicate that the mammalian retromer complex assembles by sequential association of SNX1/2 and Vps26-Vps29-Vps35 subcomplexes on endosomal membranes and that SNX1 and SNX2 play interchangeable but essential roles.
16487940 Overexpression of SNX1 is able to attenuate the effect of SNX5 on epidermal growth factor (EGF) receptor degradation.
16407403 These findings establish an essential role for endogenous SNX1 in sorting activated PAR1 to a distinct lysosomal degradative pathway that is independent of retromer, Hrs, and Tsg101.
15882442 HkRP1 is involved in the process of tubulation of sorting nexin-1 positive membranes from early endosome subdomains
15673616 NMR structure of the PX domain of SNX1 reveals an overall fold that is similar to high-affinity PX domains
15498486 SNX1 associates with a microdomain of the early endosome where it regulates tubular-based endosome-to-trans Golgi network retrieval of the cation-independent mannose-6-phosphate receptor.
12657642 identified sorting nexin 1 (SNX1) as a novel partner of enterothelin-1 (ENT-1); show that Ent-1 and SNX1 co-eluted in macromolecular complexes containing part of epidermal growth factor receptor(EGFR)
12198132 PX domain-dependent/early endosomal association of SNX1 is important for its ability to regulate the targeting of internalized epidermal growth factor receptor for lysosomal degradation
12058063 controls down-regulation of protease-activated receptor-1

AA Sequence

MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINN      1 - 70
GSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQE     71 - 140
DQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPP    141 - 210
PPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLS    211 - 280
GAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKS    281 - 350
LAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW    351 - 420
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFK    421 - 490
NHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS                                          491 - 522
//

Text Mined References (62)

PMID Year Title
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
25653196 2015 EGF?stimulated AKT activation is mediated by EGFR recycling via an early endocytic pathway in a gefitinib?resistant human lung cancer cell line.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24835695 2014 MiR-95 induces proliferation and chemo- or radioresistance through directly targeting sorting nexin1 (SNX1) in non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152498 2013 Sorting nexin 1 loss results in D5 dopamine receptor dysfunction in human renal proximal tubule cells and hypertension in mice.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22859339 2012 Silencing of SNX1 by siRNA stimulates the ligand-induced endocytosis of EGFR and increases EGFR phosphorylation in gefitinib-resistant human lung cancer cell lines.
22719997 2012 SNX12 role in endosome membrane transport.
22673115 2012 Identification of Alzheimer disease-associated variants in genes that regulate retromer function.
22431521 2012 The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21973056 2012 SNX-BAR-mediated endosome tubulation is co-ordinated with endosome maturation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21427358 2011 MicroRNA-95 promotes cell proliferation and targets sorting Nexin 1 in human colorectal carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21048941 2010 The SNX-PX-BAR family in macropinocytosis: the regulation of macropinosome formation by SNX-PX-BAR proteins.
21040701 2010 Implication of mouse Vps26b-Vps29-Vps35 retromer complex in sortilin trafficking.
20604901 2010 A novel, retromer-independent role for sorting nexins 1 and 2 in RhoG-dependent membrane remodeling.
20070609 2010 Regulation of P2Y1 receptor traffic by sorting Nexin 1 is retromer independent.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19935774 2009 The retromer component SNX6 interacts with dynactin p150(Glued) and mediates endosome-to-TGN transport.
19874558 2009 Analysis of articulation between clathrin and retromer in retrograde sorting on early endosomes.
19816406 2009 Amphipathic motifs in BAR domains are essential for membrane curvature sensing.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19619496 2009 The retromer coat complex coordinates endosomal sorting and dynein-mediated transport, with carrier recognition by the trans-Golgi network.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18505799 2008 Sorting nexin-1 defines an early phase of Salmonella-containing vacuole-remodeling during Salmonella infection.
18088323 2008 SNX1 defines an early endosomal recycling exit for sortilin and mannose 6-phosphate receptors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17550970 2007 The retromer component sorting nexin-1 is required for efficient retrograde transport of Shiga toxin from early endosome to the trans Golgi network.
17502486 2007 EGF induces macropinocytosis and SNX1-modulated recycling of E-cadherin.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
17145813 2006 Sorting nexin 1 down-regulation promotes colon tumorigenesis.
17101778 2007 Interchangeable but essential functions of SNX1 and SNX2 in the association of retromer with endosomes and the trafficking of mannose 6-phosphate receptors.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16487940 2006 Inhibitory regulation of EGF receptor degradation by sorting nexin 5.
16407403 2006 An essential role for SNX1 in lysosomal sorting of protease-activated receptor-1: evidence for retromer-, Hrs-, and Tsg101-independent functions of sorting nexins.
15882442 2005 A novel hook-related protein family and the characterization of hook-related protein 1.
15673616 2005 Determinants of the endosomal localization of sorting nexin 1.
15498486 2004 Sorting nexin-1 mediates tubular endosome-to-TGN transport through coincidence sensing of high- curvature membranes and 3-phosphoinositides.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12657642 2003 Enterophilin-1, a new partner of sorting nexin 1, decreases cell surface epidermal growth factor receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198132 2002 The phox homology (PX) domain-dependent, 3-phosphoinositide-mediated association of sorting nexin-1 with an early sorting endosomal compartment is required for its ability to regulate epidermal growth factor receptor degradation.
12058063 2002 Down-regulation of protease-activated receptor-1 is regulated by sorting nexin 1.
11997453 2002 Endosomal localization and function of sorting nexin 1.
11410165 2001 Structural and functional characterization of the human gene for sorting nexin 1 (SNX1).
11309204 2001 Self-assembly and binding of a sorting nexin to sorting endosomes.
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11110793 2001 Hrs interacts with sorting nexin 1 and regulates degradation of epidermal growth factor receptor.
11102511 2000 Human orthologs of yeast vacuolar protein sorting proteins Vps26, 29, and 35: assembly into multimeric complexes.
9819414 1998 Identification of a family of sorting nexin molecules and characterization of their association with receptors.
9110174 1997 Large-scale concatenation cDNA sequencing.
8638121 1996 Enhanced degradation of EGF receptors by a sorting nexin, SNX1.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.