Property Summary

NCBI Gene PubMed Count 26
PubMed Score 27.87
PubTator Score 18.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -2.700 1.0e-11
medulloblastoma -2.800 1.5e-07
atypical teratoid / rhabdoid tumor -2.000 6.0e-04
medulloblastoma, large-cell -2.300 3.6e-04
pilocytic astrocytoma 1.700 8.7e-05
lung carcinoma 3.200 1.2e-28
progressive supranuclear palsy 1.100 4.3e-02

 GO Process (1)

Gene RIF (6)

PMID Text
21358174 Brain-specific gamma1-syntrophin participates in gamma-enolase translocation towards the plasma membrane, a pre-requisite for its neurotrophic activity.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19836389 Includes a comparison of the Drosophila and human syntrophin proteins.
15088139 Observational study of genotype prevalence. (HuGE Navigator)
10747910 suggests a differentiated role of a modified dystrophin-associated complex in the central nervous system

AA Sequence

MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTIRRQTVGGFGL      1 - 70
SIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLK     71 - 140
RAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIP    141 - 210
LLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPV    211 - 280
NQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDL    281 - 350
LDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF    351 - 420
ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAKVACL    421 - 490
DPLFLGNQATASTAASSATTSKAKYTT                                               491 - 517
//

Text Mined References (27)

PMID Year Title
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21358174 2010 ?-1-syntrophin mediates trafficking of ?-enolase towards the plasma membrane and enhances its neurotrophic activity.
21314952 2011 Bioinformatic analyses identifies novel protein-coding pharmacogenomic markers associated with paclitaxel sensitivity in NCI60 cancer cell lines.
21151896 2010 Genomic aberrations in lung adenocarcinoma in never smokers.
20838928 2011 Population and computational analysis of the MGEA6 P521A variation as a risk factor for familial idiopathic basal ganglia calcification (Fahr's disease).
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19836389 2010 Syntrophin-2 is required for eye development in Drosophila.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903307 2007 Framingham Heart Study genome-wide association: results for pulmonary function measures.
16533813 2006 Syntrophins regulate alpha1D-adrenergic receptors through a PDZ domain-mediated interaction.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485858 2004 The phosphoinositol 3,4-bisphosphate-binding protein TAPP1 interacts with syntrophins and regulates actin cytoskeletal organization.
15088139 2004 SNTG1, the gene encoding gamma1-syntrophin: a candidate gene for idiopathic scoliosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11352924 2001 Interaction of gamma 1-syntrophin with diacylglycerol kinase-zeta. Regulation of nuclear localization by PDZ interactions.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10747910 2000 Gamma1- and gamma2-syntrophins, two novel dystrophin-binding proteins localized in neuronal cells.