Property Summary

NCBI Gene PubMed Count 30
PubMed Score 14.68
PubTator Score 4.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.300 1.3e-04
astrocytic glioma -1.500 1.0e-02
ependymoma -1.600 3.2e-02
oligodendroglioma -1.300 3.1e-02
medulloblastoma, large-cell -1.400 8.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.116 2.7e-03
juvenile dermatomyositis 1.018 5.7e-10
primary pancreatic ductal adenocarcinoma 1.187 5.3e-03
aldosterone-producing adenoma -1.111 2.0e-02
Polycystic Ovary Syndrome -1.097 2.5e-02
mucosa-associated lymphoid tissue lympho... 1.524 1.8e-02
ductal carcinoma in situ -1.300 5.7e-04
invasive ductal carcinoma -1.900 1.3e-04
ovarian cancer -1.600 7.1e-10
pancreatic cancer 1.300 2.0e-03

Gene RIF (3)

PMID Text
22735534 conformational plasticity of the native ensemble of this PDZ domain and the regulation of insulin secretion
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntrophin
12899872 patients with deficiency of beta2-syntrophin and alpha-dystrobrevin presented with severe congenital weakness and died in the first year of life

AA Sequence

MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAF      1 - 70
NGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPI     71 - 140
LISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV    141 - 210
SDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLIL    211 - 280
RCKDTATAHSWFVAIHTNIMALLPQVLAELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLM    281 - 350
AVTEKDLLLYDCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVE    351 - 420
THRDLSSWTRILVQGCHAAAELIKEVSLGCMLNGQEVRLTIHYENGFTISRENGGSSSILYRYPFERLKM    421 - 490
SADDGIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV                        491 - 540
//

Text Mined References (41)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24234652 2014 LRP4 third ?-propeller domain mutations cause novel congenital myasthenia by compromising agrin-mediated MuSK signaling in a position-specific manner.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22735534 2012 Equilibrium unfolding of the PDZ domain of ?2-syntrophin.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19786618 2009 TAPP2 links phosphoinositide 3-kinase signaling to B-cell adhesion through interaction with the cytoskeletal protein utrophin: expression of a novel cell adhesion-promoting complex in B-cell leukemia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16533813 2006 Syntrophins regulate alpha1D-adrenergic receptors through a PDZ domain-mediated interaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15024025 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins.
14759258 2004 An unappreciated role for RNA surveillance.
12899872 2003 Deficiency of the syntrophins and alpha-dystrobrevin in patients with inherited myopathy.
12763866 2003 Characterization of PISP, a novel single-PDZ protein that binds to all plasma membrane Ca2+-ATPase b-splice variants.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417987 2002 A missense mutation (R565W) in cirhin (FLJ14728) in North American Indian childhood cirrhosis.
12206805 2002 Dystrobrevin dynamics in muscle-cell signalling: a possible target for therapeutic intervention in Duchenne muscular dystrophy?
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
12054535 2002 The carboxyterminus of the ATP-binding cassette transporter A1 interacts with a beta2-syntrophin/utrophin complex.
11483505 2001 Dephosphorylation of beta2-syntrophin and Ca2+/mu-calpain-mediated cleavage of ICA512 upon stimulation of insulin secretion.
11352924 2001 Interaction of gamma 1-syntrophin with diacylglycerol kinase-zeta. Regulation of nuclear localization by PDZ interactions.
11168526 2001 Differential targeting of components of the dystrophin complex to the postsynaptic membrane.
11043403 2000 The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells.
10995443 2000 Absence of alpha-syntrophin leads to structurally aberrant neuromuscular synapses deficient in utrophin.
10725395 2000 The neuregulin receptor ErbB-4 interacts with PDZ-containing proteins at neuronal synapses.
10404183 1999 Interactions between beta 2-syntrophin and a family of microtubule-associated serine/threonine kinases.
9412493 1998 Interaction of muscle and brain sodium channels with multiple members of the syntrophin family of dystrophin-associated proteins.
8576247 1996 The three human syntrophin genes are expressed in diverse tissues, have distinct chromosomal locations, and each bind to dystrophin and its relatives.
8183929 1994 Cloning of human basic A1, a distinct 59-kDa dystrophin-associated protein encoded on chromosome 8q23-24.