Property Summary

NCBI Gene PubMed Count 30
PubMed Score 14.71
PubTator Score 4.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
aldosterone-producing adenoma -1.111 2.0e-02
astrocytic glioma -1.500 1.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.001 1.0e-02
ductal carcinoma in situ -1.200 8.1e-04
ependymoma -1.100 3.7e-02
gastric cancer 1.300 1.3e-04
invasive ductal carcinoma -1.200 7.7e-04
juvenile dermatomyositis 1.018 5.7e-10
medulloblastoma, large-cell -1.400 8.4e-03
mucosa-associated lymphoid tissue lympho... 1.524 1.8e-02
oligodendroglioma -1.300 3.1e-02
ovarian cancer -1.600 7.1e-10
pancreatic cancer 1.300 2.0e-03
Polycystic ovary syndrome -1.097 2.5e-02
primary pancreatic ductal adenocarcinoma 1.187 5.3e-03

Gene RIF (3)

AA Sequence

MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAF      1 - 70
NGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPI     71 - 140
LISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV    141 - 210
SDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLIL    211 - 280
RCKDTATAHSWFVAIHTNIMALLPQVLAELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLM    281 - 350
AVTEKDLLLYDCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVE    351 - 420
THRDLSSWTRILVQGCHAAAELIKEVSLGCMLNGQEVRLTIHYENGFTISRENGGSSSILYRYPFERLKM    421 - 490
SADDGIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV                        491 - 540
//

Text Mined References (41)

PMID Year Title