Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1.33
PubTator Score 42.93

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (1)

PMID Text
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide G (SNRPG), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SNRPG is increased by RRE

AA Sequence

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML      1 - 70
EALERV                                                                     71 - 76
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21816274 2011 Structure of a key intermediate of the SMN complex reveals Gemin2's crucial function in snRNP assembly.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19928837 2010 The SMN interactome includes Myb-binding protein 1a.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15939020 2005 The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14603251 2003 TACC1-chTOG-Aurora A protein complex in breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12165861 2002 Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
11574479 2001 Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein.
11226169 2001 Sm protein-Sm site RNA interactions within the inner ring of the spliceosomal snRNP core structure.
10725331 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.
10601333 1999 Gemin3: A novel DEAD box protein that interacts with SMN, the spinal muscular atrophy gene product, and is a component of gems.
10556282 1999 Essential role for the tudor domain of SMN in spliceosomal U snRNP assembly: implications for spinal muscular atrophy.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.
9417867 1997 Multiple protein: protein interactions between the snRNP common core proteins.
9323129 1997 The spinal muscular atrophy disease gene product, SMN, and its associated protein SIP1 are in a complex with spliceosomal snRNP proteins.
9020971 1997 Electron microscopy of assembly intermediates of the snRNP core: morphological similarities between the RNA-free (E.F.G) protein heteromer and the intact snRNP core.
7744013 1995 snRNP Sm proteins share two evolutionarily conserved sequence motifs which are involved in Sm protein-protein interactions.
1387914 1992 Direct binding of small nuclear ribonucleoprotein G to the Sm site of small nuclear RNA. Ultraviolet light cross-linking of protein G to the AAU stretch within the Sm site (AAUUUGUGG) of U1 small nuclear ribonucleoprotein reconstituted in vitro.