Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1.33
PubTator Score 42.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P62308 D6W5G6 Q15357 Q6IB86 snRNP-G
Symbols SMG
Sm-G

Gene

PDB

3JCR   3CW1   3PGW   3S6N   4F7U   4PJO   4V98   4WZJ  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (1)

PMID Text
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide G (SNRPG), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SNRPG is increased by RRE

AA Sequence

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML      1 - 70
EALERV                                                                     71 - 76
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21816274 2011 Structure of a key intermediate of the SMN complex reveals Gemin2's crucial function in snRNP assembly.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19928837 2010 The SMN interactome includes Myb-binding protein 1a.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
More...