Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1.81
PubTator Score 13.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma 1.200 7.2e-08
group 3 medulloblastoma 2.000 1.5e-05
medulloblastoma, large-cell 1.500 3.4e-05
primitive neuroectodermal tumor 1.300 1.3e-04
lung cancer 1.800 2.7e-05
pediatric high grade glioma 1.300 1.0e-06
atypical teratoid/rhabdoid tumor 1.300 2.0e-08
posterior fossa group A ependymoma 1.100 1.0e-07

 GO Function (1)

Protein-protein Interaction (185)

PRMT5   U2SURP   DHX15   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   WBP4   BCAS2   SMNDC1   PCF11   SNUPN   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   HNRNPA1   SNRPA1   HNRNPL   HNRNPA2B1   U2AF2   PTBP1   HNRNPH1   CSTF2   RBMX   PAPOLA   HNRNPA3   HNRNPM   HNRNPF   HNRNPH2   GEMIN4   HNRNPK   SNRPG   LSM3   LSM6   TRA2B   SNURF   LSM11   SRSF3   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF1   SRSF4   CPSF1   SF3A3   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   HNRNPD   SLBP   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   SNRNP35   SMN2   USP39   SNRNP48   PRPF8   FIP1L1   CWC27   DDX46   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PDCD7   PRPF38A   ZCRB1   GEMIN5   ZNF473   U2AF1L4   SNRNP27   PRPF31   GEMIN6   DHX38   CLP1   LSM10   MAGOHB   PPWD1   SNRNP40   RBM17   RNPC3   TGS1   CDC5L   WDR77   HNRNPUL1   SNRNP25   SF3B5   UPF3B   CRNKL1   CSTF2T   PHAX   GEMIN7   CWC22   RBM22   GEMIN8   CWC25   CWC15   CPSF2   NXF1   ZMAT5   DDX20   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM5   LSM4   RBM8A   SNRPC   LSM2   SF3B1   TOE1   PRPF6   SNRNP200   TFIP11   TUT1   CWF19L2   HTATSF1   EFTUD2   PRPF4   RSRC1   SNRPGP15   XAB2   GPATCH1   CMTR2   DHX35   PAXBP1   SART3   DDX23   SLC4A1AP   WDR83   MEPCE   PIGR   SNW1   ZG16B   AKAP7   ZRSR2   SNRPD2   CLNS1A   LSM1   GPBP1L1   BPIFA2   TXNL4A   PPIE   SNRPD3   CST5   SNRPD1   SNRPB   KLHL8   GPATCH11   GEMIN2   TSSC4   IGHA1   CST1   CST4   SMR3B  

Gene RIF (1)

PMID Text
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide F (SNRPF), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL      1 - 70
YIRGVEEEEEDGEMRE                                                           71 - 86
//

Text Mined References (37)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15939020 2005 The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11756452 2002 A novel WD repeat protein component of the methylosome binds Sm proteins.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
11574479 2001 Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein.
11226169 2001 Sm protein-Sm site RNA interactions within the inner ring of the spliceosomal snRNP core structure.
10725331 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.
10601333 1999 Gemin3: A novel DEAD box protein that interacts with SMN, the spinal muscular atrophy gene product, and is a component of gems.
10556282 1999 Essential role for the tudor domain of SMN in spliceosomal U snRNP assembly: implications for spinal muscular atrophy.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.
10025403 1999 Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
9417867 1997 Multiple protein: protein interactions between the snRNP common core proteins.
9020971 1997 Electron microscopy of assembly intermediates of the snRNP core: morphological similarities between the RNA-free (E.F.G) protein heteromer and the intact snRNP core.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7744013 1995 snRNP Sm proteins share two evolutionarily conserved sequence motifs which are involved in Sm protein-protein interactions.
2974540 1988 Direct cross-linking of snRNP proteins F and 70K to snRNAs by ultra-violet radiation in situ.
2522439 1989 Cytoplasmic assembly and nuclear accumulation of mature small nuclear ribonucleoprotein particles.
1688550 1990 Cytoplasmic assembly of small nuclear ribonucleoprotein particles from 6 S and 20 S RNA-free intermediates in L929 mouse fibroblasts.