Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1.81
PubTator Score 13.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 2.01288247274431E-8
glioblastoma 5572 7.21258767400048E-8
posterior fossa group A ependymoma 1511 1.04496307074955E-7
pediatric high grade glioma 2712 1.03433517447694E-6
group 3 medulloblastoma 2254 1.50322887191132E-5
lung cancer 4473 2.72300086223645E-5
medulloblastoma, large-cell 6234 3.35442961093157E-5
primitive neuroectodermal tumor 3031 1.26736225096944E-4
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 1.0

Expression

  Differential Expression (8)

Synonym

Accession P62306 A2VCR2 B2R498 Q15356 Q6IBQ1 Q6P4I0 snRNP-F
Symbols SMF
Sm-F
snRNP-F

Gene

PDB

3JCR   3CW1   3PGW   3S6N   4F7U   4PJO   4V98   4WZJ  

  Ortholog (12)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

 GO Function (1)

Gene RIF (1)

PMID Text
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide F (SNRPF), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL      1 - 70
YIRGVEEEEEDGEMRE                                                           71 - 86
//

Text Mined References (37)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
More...