Property Summary

NCBI Gene PubMed Count 41
PubMed Score 589.27
PubTator Score 35.87

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 OMIM Phenotype (1)

Gene RIF (5)

AA Sequence

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS      1 - 70
RKQLGRIMLKGDNITLLQSVSN                                                     71 - 92
//

Text Mined References (46)

PMID Year Title