Property Summary

NCBI Gene PubMed Count 41
PubMed Score 540.77
PubTator Score 35.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

 GO Function (1)

 OMIM Phenotype (1)

Protein-protein Interaction (186)

PRMT5   U2SURP   DHX15   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   WBP4   BCAS2   SMNDC1   PCF11   SNUPN   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   HNRNPA1   SNRPA1   HNRNPL   HNRNPA2B1   U2AF2   PTBP1   HNRNPH1   CSTF2   RBMX   PAPOLA   HNRNPA3   HNRNPM   HNRNPF   HNRNPH2   GEMIN4   HNRNPK   SNRPF   SNRPG   LSM3   LSM6   TRA2B   SNURF   LSM11   SRSF3   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF1   SRSF4   CPSF1   SF3A3   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   HNRNPD   SLBP   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   SNRNP35   SMN2   USP39   SNRNP48   PRPF8   FIP1L1   CWC27   DDX46   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PDCD7   PRPF38A   ZCRB1   GEMIN5   ZNF473   U2AF1L4   SNRNP27   PRPF31   GEMIN6   DHX38   CLP1   LSM10   MAGOHB   PPWD1   SNRNP40   RBM17   RNPC3   TGS1   CDC5L   WDR77   HNRNPUL1   SNRNP25   SF3B5   UPF3B   CRNKL1   CSTF2T   PHAX   GEMIN7   CWC22   RBM22   GEMIN8   CWC25   CWC15   CPSF2   NXF1   ZMAT5   DDX20   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM5   LSM4   RBM8A   LSM2   SF3B1   TOE1   PRPF6   SNRNP200   HTATSF1   TFIP11   TUT1   CWF19L2   EFTUD2   PRPF4   RSRC1   SNRPGP15   XAB2   GPATCH1   CMTR2   DHX35   PAXBP1   SLC4A1AP   SART3   ZNF830   CWF19L1   DDX23   GCFC2   WDR83   MEPCE   SNW1   AKAP7   SNRPD2   CLNS1A   CCDC12   DGCR14   ZGPAT   CCDC84   GPATCH11   RBM5   RBM42   ZRSR2   PPIE   EAPP   SNRPD3   SF3B6   PRKRIP1   IK   SNRPD1   SNRPB   GEMIN2   TSSC4  

Gene RIF (5)

PMID Text
23358685 Overexpression of SNRPE is associated with highly aggressive breast cancers.
23246290 Mutations in SNRPE, which encodes a core protein of the spliceosome, cause autosomal-dominant hypotrichosis simplex
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide E (SNRPE), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SNRPE is increased by RRE
18208561 growth arrest by SmE directly correlates with the reduction of cyclin E, CDK2, CDC25C and CDC2 expression, and up-regulation of p27Kip
12022225 In the SME intron, the position of the branchpoint A residue within the region base paired with U12 differs from that in P120 and XTF.

AA Sequence

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS      1 - 70
RKQLGRIMLKGDNITLLQSVSN                                                     71 - 92
//

Text Mined References (46)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23358685 2013 Targeting the deregulated spliceosome core machinery in cancer cells triggers mTOR blockade and autophagy.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
23246290 2013 Mutations in SNRPE, which encodes a core protein of the spliceosome, cause autosomal-dominant hypotrichosis simplex.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18208561 2008 Spliceosomal protein E regulates neoplastic cell growth by modulating expression of cyclin E/CDK2 and G2/M checkpoint proteins.
18082603 2007 Purification of human telomerase complexes identifies factors involved in telomerase biogenesis and telomere length regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12065586 2002 Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11756452 2002 A novel WD repeat protein component of the methylosome binds Sm proteins.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
11714716 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins.
11574479 2001 Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein.
11226169 2001 Sm protein-Sm site RNA interactions within the inner ring of the spliceosomal snRNP core structure.
10725331 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.
10601333 1999 Gemin3: A novel DEAD box protein that interacts with SMN, the spinal muscular atrophy gene product, and is a component of gems.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.
10025403 1999 Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
9417867 1997 Multiple protein: protein interactions between the snRNP common core proteins.
9323129 1997 The spinal muscular atrophy disease gene product, SMN, and its associated protein SIP1 are in a complex with spliceosomal snRNP proteins.
9020971 1997 Electron microscopy of assembly intermediates of the snRNP core: morphological similarities between the RNA-free (E.F.G) protein heteromer and the intact snRNP core.
7821789 1994 Construction of a human full-length cDNA bank.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
2974540 1988 Direct cross-linking of snRNP proteins F and 70K to snRNAs by ultra-violet radiation in situ.
2974536 1988 The complete primary structure of the human snRNP E protein.
2972723 1988 The small nuclear ribonucleoprotein E protein gene contains four introns and has upstream similarities to genes for ribosomal proteins.
2522439 1989 Cytoplasmic assembly and nuclear accumulation of mature small nuclear ribonucleoprotein particles.
2440864 1987 DNA sequence of a human Sm autoimmune antigen. The multigene family contains a processed pseudogene.
2143747 1990 Assignment of the gene for the small nuclear ribonucleoprotein E (SNRPE) to human chromosome 1q25-q43.
1835977 1991 Transcriptional regulation of the small nuclear ribonucleoprotein E protein gene. Identification of cis-acting sequences with homology to genes encoding ribosomal proteins.
1688550 1990 Cytoplasmic assembly of small nuclear ribonucleoprotein particles from 6 S and 20 S RNA-free intermediates in L929 mouse fibroblasts.