Property Summary

NCBI Gene PubMed Count 42
PubMed Score 39.07
PubTator Score 18.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.093 3.9e-02
Multiple myeloma 1.212 1.0e-02
lung cancer 2.000 2.8e-05
diabetes mellitus -1.100 1.2e-03
sonic hedgehog group medulloblastoma 1.300 1.3e-06
ovarian cancer -1.100 4.1e-03

 GO Function (1)

Gene RIF (1)

PMID Text
11780068 U2 snRNPs interact with the HIV-1 Tat cofactor TAT-SF1 and stimulate transcription from the HIV-1 LTR promoter

AA Sequence

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV      1 - 70
KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK                           71 - 118
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12975319 2003 Unique Sm core structure of U7 snRNPs: assembly by a specialized SMN complex and the role of a new component, Lsm11, in histone RNA processing.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12065586 2002 Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11780068 2001 Stimulatory effect of splicing factors on transcriptional elongation.
11756452 2002 A novel WD repeat protein component of the methylosome binds Sm proteins.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
11714716 2002 Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins.
11226169 2001 Sm protein-Sm site RNA interactions within the inner ring of the spliceosomal snRNP core structure.
11135666 2001 SMN tudor domain structure and its interaction with the Sm proteins.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
10942426 2000 Characterization of a nuclear 20S complex containing the survival of motor neurons (SMN) protein and a specific subset of spliceosomal Sm proteins.
10725331 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.
10601333 1999 Gemin3: A novel DEAD box protein that interacts with SMN, the spinal muscular atrophy gene product, and is a component of gems.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.
10025403 1999 Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
9417867 1997 Multiple protein: protein interactions between the snRNP common core proteins.
9323129 1997 The spinal muscular atrophy disease gene product, SMN, and its associated protein SIP1 are in a complex with spliceosomal snRNP proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7527560 1994 cDNA cloning of the Sm proteins D2 and D3 from human small nuclear ribonucleoproteins: evidence for a direct D1-D2 interaction.
3260384 1988 Molecular cloning of a cDNA encoding the human Sm-D autoantigen.
1701240 1990 Evidence for three distinct D proteins, which react differentially with anti-Sm autoantibodies, in the cores of the major snRNPs U1, U2, U4/U6 and U5.