Property Summary

NCBI Gene PubMed Count 42
PubMed Score 44.92
PubTator Score 18.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 1.2e-03
lung cancer 2.000 2.8e-05
Multiple myeloma 1.212 1.0e-02
ovarian cancer -1.100 4.1e-03
sonic hedgehog group medulloblastoma 1.300 1.3e-06
Waldenstrons macroglobulinemia 1.093 3.9e-02

 GO Function (1)

PDB (12)

Gene RIF (1)

AA Sequence

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV      1 - 70
KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK                           71 - 118
//

Text Mined References (53)

PMID Year Title