Property Summary

NCBI Gene PubMed Count 49
PubMed Score 241.46
PubTator Score 77.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.400 3.0e-02
atypical teratoid/rhabdoid tumor 1.100 2.8e-05
dermatomyositis 1.400 2.8e-03
gastric carcinoma 1.100 4.7e-02
group 3 medulloblastoma 1.500 7.2e-04
lung cancer 2.300 3.7e-05
medulloblastoma, large-cell 1.400 9.8e-05
Multiple myeloma 1.277 3.1e-04
non-small cell lung cancer 1.138 9.5e-16
ovarian cancer 1.800 5.3e-04
Pneumonia -1.500 5.0e-03
Polycystic ovary syndrome 1.151 5.7e-03
psoriasis 1.100 1.5e-03

Gene RIF (4)

AA Sequence

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL      1 - 70
PDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR                          71 - 119
//

Text Mined References (55)

PMID Year Title