1. Home
  2. Targets
  3. nucleic acid binding
  4. RNA binding protein
  5. mRNA processing factor
  6. mRNA splicing factor
  7. U2 small nuclear ribonucleoprotein B''

Tdark U2 small nuclear ribonucleoprotein B''

Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA only in presence of the U2A' protein.

The protein encoded by this gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A'. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 27
PubMed Score 3.02
PubTator Score 1.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 7.6e-07
lung cancer 4473 4.3e-03
breast carcinoma 1614 3.0e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.700 4.3e-03
breast carcinoma 1.100 3.0e-02
sonic hedgehog group medulloblastoma 1.200 7.6e-07

Synonym

Accession P08579 B2R7J3 D3DW21 Q9UJD4 U2 snRNP B''
Symbols Msl1
U2B''

Gene

SNRPB2

PANTHER Protein Class (4)

PDB

1A9N  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (13)

See all...

 GO Function (3)

 GO Component (5)

 GO Process (1)

 Compartment GO Term (32)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (8)

Protein-protein Interaction (90)

U2SURP   DHX15   SART1   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   WBP4   BCAS2   SMNDC1   PCF11   CD2BP2   CPSF4   LSM8   SYF2   U2AF2   CSTF2   PAPOLA   LSM3   LSM6   TRA2B   SNURF   SRSF3   U2AF1   SRSF2   CSTF1   SRSF1   SRSF4   CPSF1   SF3A3   CSTF3   SRSF9   SRSF5   SRSF6   SF3B2   RNPS1   SF3B3   SF3B4   SF3A2   SF3A1   SF1   USP39   PRPF8   FIP1L1   CWC27   DDX46   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   DHX38   CLP1   MAGOHB   PPWD1   SNRNP40   RBM17   CDC5L   HNRNPUL1   SF3B5   UPF3B   CRNKL1   CSTF2T   CWC22   RBM22   CWC25   CWC15   CPSF2   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM5   LSM4   RBM8A  

Gene RIF (2)

PMID Text
24866816 Data suggest that protein-protein interactions localize U2A' (SNRPA1) to the U2 snRNP (U2 small nuclear ribonucleoprotein) and exclude it from the U1 snRNP, rather than to enhance U2 snRNA (U2 small nuclear RNA; RNU2-1) binding of U2B'' (SNRPB2).
11780068 U2 snRNPs interact with the HIV-1 Tat cofactor TAT-SF1 and stimulate transcription from the HIV-1 LTR promoter

AA Sequence 

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQ      1 - 70
GFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTP     71 - 140
NPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGF    141 - 210
KITPSHAMKITYAKK                                                           211 - 225
//

Text Mined References (30)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24866816 2014 Binding affinity and cooperativity control U2B?/snRNA/U2A' RNP formation.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12084575 2002 Crooked neck is a component of the human spliceosome and implicated in the splicing process.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11780068 2001 Stimulatory effect of splicing factors on transcriptional elongation.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11149922 2001 A functional interaction between the survival motor neuron complex and RNA polymerase II.
10556282 1999 Essential role for the tudor domain of SMN in spliceosomal U snRNP assembly: implications for spinal muscular atrophy.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9716128 1998 Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
9576861 1998 Structural/functional properties of a mammalian multi-component structure containing all major spliceosomal small nuclear ribonucleoprotein particles.
9323129 1997 The spinal muscular atrophy disease gene product, SMN, and its associated protein SIP1 are in a complex with spliceosomal snRNP proteins.
9016565 1997 Association of U2 snRNP with the spliceosomal complex E.
7593271 1995 U2-snRNP B" protein gene is an early growth-inducible gene.
2951739 1987 Analysis of a cDNA clone expressing a human autoimmune antigen: full-length sequence of the U2 small nuclear RNA-associated B" antigen.
2139037 1990 Nuclear exchange of the U1 and U2 snRNP-specific proteins.